DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and f-cup

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001262544.1 Gene:f-cup / 41677 FlyBaseID:FBgn0028487 Length:802 Species:Drosophila melanogaster


Alignment Length:475 Identity:115/475 - (24%)
Similarity:188/475 - (39%) Gaps:115/475 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TGPSQAKEPPIQSLDEFRQRYLLPLISSDTRNCSL-------NACESLGIVSQLLMLINSMPNGT 79
            :.||.::.|  :|....||   ..::.|...||:.       :..|...:::|.|..: :..:||
  Fly    53 SNPSTSRIP--RSAQSPRQ---ASVVHSPRTNCAFRPIFHERSTHEDDQVLTQELWKL-ARKSGT 111

  Fly    80 QSAAND--KKPPKSKANGHNDGDVNGGEINAMSHLANFDLVKRVRQIESRLRSVEQPVWHLATGS 142
            .:.:|.  .:.||...      |:|  |.:|.|...|.:          :|...|:..|      
  Fly   112 LNLSNKALARVPKRLY------DIN--EADADSKAVNLE----------QLTIKEEDAW------ 152

  Fly   143 QIEWNHCTSGVCRCNPDTKSFTCWNTNLKSVPVTQVIPMNMVNIDLSRNILSTLHK--DTFRGLT 205
               ||.                              :|:|  |:|||.|.|:.:..  :..:.||
  Fly   153 ---WNQ------------------------------VPLN--NLDLSSNTLTHISPKIENLQSLT 182

  Fly   206 VLK--------------------ELDISHNVLDFLPFDLFQDLDSLLVLRIQNNQLEDIDHRTFW 250
            ||.                    .|::|||.|..||..:: .|..|..|.|..|:..:: :....
  Fly   183 VLTLHDNALVELPPEIGKLEKLVRLNVSHNKLSQLPRAMY-SLPELRHLNISYNEFVEL-NPDIS 245

  Fly   251 KLRNLNILDLSKNEIGMLPESIFYHAQRLTVINMCDNQIQNFPPNLLRDQLMLEELDMSRNKISE 315
            .|..|..||...|.|..||..|.: ..|||.:.:..|.|:..||:|: :...|:::|:..|.::.
  Fly   246 DLHMLEFLDGGHNNIQSLPGGIGF-LVRLTALLLPYNHIKELPPDLV-NMRSLQKIDLMHNDLTS 308

  Fly   316 LSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDL 380
            |.. .:..|.||..|....|.|.::.:  |.|..:|..|...||.|..:...:.:||.:|..|||
  Fly   309 LPE-DMGLLRKLDCLYLQHNDILELPE--FEGNEALNELHASNNFIKIIPKAMCSNLPHLKILDL 370

  Fly   381 TTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQ-GL 444
            ..|:|:.:.....: |.|||.|.:..|::|.:|..| .:::.|..|.:..|.:.|:..|..| | 
  Fly   371 RDNKITELPDELCL-LRNLNRLDVSNNTISVLPVTL-SSLAHLISLQVEGNPIKTIRRDILQCG- 432

  Fly   445 NNLKILLLNNNILKNFDARA 464
                    ...|||....||
  Fly   433 --------TTRILKTLHDRA 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 23/80 (29%)
leucine-rich repeat 187..206 CDD:275380 6/20 (30%)
LRR_RI <201..386 CDD:238064 57/204 (28%)
leucine-rich repeat 207..230 CDD:275380 9/42 (21%)
leucine-rich repeat 231..254 CDD:275380 5/22 (23%)
LRR_8 253..313 CDD:290566 19/59 (32%)
leucine-rich repeat 255..278 CDD:275380 8/22 (36%)
leucine-rich repeat 279..302 CDD:275380 7/22 (32%)
LRR_8 303..361 CDD:290566 16/57 (28%)
leucine-rich repeat 303..326 CDD:275380 5/22 (23%)
leucine-rich repeat 327..350 CDD:275380 6/22 (27%)
LRR_8 349..407 CDD:290566 18/57 (32%)
LRR_4 350..390 CDD:289563 13/39 (33%)
leucine-rich repeat 351..374 CDD:275380 7/22 (32%)
leucine-rich repeat 375..398 CDD:275380 7/22 (32%)
LRR_8 398..>443 CDD:290566 14/45 (31%)
leucine-rich repeat 399..422 CDD:275380 7/22 (32%)
leucine-rich repeat 423..443 CDD:275380 6/20 (30%)
leucine-rich repeat 471..494 CDD:275380
LRRCT 503..554 CDD:214507
f-cupNP_001262544.1 leucine-rich repeat 111..140 CDD:275380 9/36 (25%)
LRR_RI 155..>377 CDD:238064 66/260 (25%)
leucine-rich repeat 158..180 CDD:275380 7/23 (30%)
LRR_8 180..235 CDD:290566 15/55 (27%)
leucine-rich repeat 181..203 CDD:275380 4/21 (19%)
leucine-rich repeat 204..226 CDD:275380 8/22 (36%)
LRR_8 225..283 CDD:290566 17/59 (29%)
leucine-rich repeat 227..249 CDD:275380 5/22 (23%)
leucine-rich repeat 250..272 CDD:275380 8/22 (36%)
LRR_8 272..329 CDD:290566 17/58 (29%)
leucine-rich repeat 273..295 CDD:275380 7/22 (32%)
leucine-rich repeat 296..318 CDD:275380 5/22 (23%)
LRR_8 317..375 CDD:290566 19/59 (32%)
leucine-rich repeat 319..340 CDD:275380 6/22 (27%)
leucine-rich repeat 341..364 CDD:275380 7/22 (32%)
leucine-rich repeat 389..410 CDD:275380 6/21 (29%)
leucine-rich repeat 411..430 CDD:275380 5/18 (28%)
leucine-rich repeat 627..650 CDD:275380
leucine-rich repeat 651..669 CDD:275380
leucine-rich repeat 697..719 CDD:275380
LRR_8 719..777 CDD:290566
leucine-rich repeat 720..743 CDD:275380
leucine-rich repeat 744..766 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.