DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and rtn4rl2a

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_982346.1 Gene:rtn4rl2a / 403307 ZFINID:ZDB-GENE-040310-4 Length:458 Species:Danio rerio


Alignment Length:358 Identity:97/358 - (27%)
Similarity:162/358 - (45%) Gaps:42/358 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 PESIFYHAQRLTVINMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFG 333
            |.::...||..|::          |..:..:.   :.:.:..|:|:||..||..:.|::.     
Zfish    51 PMTVSCQAQNFTIV----------PHGMPYES---QRVFLQNNRITELRVGSFAFGTQVL----- 97

  Fly   334 W---NQIAKIDDDFFAGLRSLRTLSLHNN-RISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFV 394
            |   |.|..|:...|:.||.|..|.|.:| .:..|.|..|..|..|.:|.:...:::.:..:.|.
Zfish    98 WLFSNNITWIEAGAFSELRDLEELDLGDNPNLHRLEGGAFRGLEKLQSLHMHRCKLAALPHDIFH 162

  Fly   395 ELNNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKN 459
            :|.:|..|:|.:|.:..|..|||.::..|::|.|..|.:.||..:.|:||.||..|||::|.::.
Zfish   163 KLYSLQFLYLQENQLHFIQDDLFADLINLSQLFLHGNRIRTLSENVFRGLVNLDRLLLHDNRVRQ 227

  Fly   460 FDARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLK 524
            .:.|||..|.||..|.:.:|.|..||..|:..:.::..::|:.|||.|.|.|..|..:.|...| 
Zfish   228 VNRRAFRDLGQLTMLFLFNNSLAELPGQAMRDVSSIEFLRLNNNPWACGCEARPLWEFFRGARL- 291

  Fly   525 LWDGQQPMCRGPGDLGGHEVGLLRYDD--LCD--------GQWASMLSLSPRLPVRKHQ-ISTPM 578
              ...:.:|..|....|.::..||..|  ||.        |...:..|...|....|:: :||..
Zfish   292 --SSSEVLCASPASRRGQDLRFLREMDFALCPLPDPGSLAGTTTTTFSTKTRWWFSKNKPVSTSK 354

  Fly   579 NYTDYFNLYLKHIYNGTTDEELKEADITSVSIK 611
            ...:..:....|.|.|      .::.:||.|.|
Zfish   355 GIFEKSSETKAHPYTG------GKSSVTSTSTK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566
leucine-rich repeat 187..206 CDD:275380
LRR_RI <201..386 CDD:238064 29/120 (24%)
leucine-rich repeat 207..230 CDD:275380
leucine-rich repeat 231..254 CDD:275380
LRR_8 253..313 CDD:290566 6/43 (14%)
leucine-rich repeat 255..278 CDD:275380 2/8 (25%)
leucine-rich repeat 279..302 CDD:275380 2/22 (9%)
LRR_8 303..361 CDD:290566 18/61 (30%)
leucine-rich repeat 303..326 CDD:275380 6/22 (27%)
leucine-rich repeat 327..350 CDD:275380 6/25 (24%)
LRR_8 349..407 CDD:290566 16/58 (28%)
LRR_4 350..390 CDD:289563 10/40 (25%)
leucine-rich repeat 351..374 CDD:275380 8/23 (35%)
leucine-rich repeat 375..398 CDD:275380 4/22 (18%)
LRR_8 398..>443 CDD:290566 15/44 (34%)
leucine-rich repeat 399..422 CDD:275380 8/22 (36%)
leucine-rich repeat 423..443 CDD:275380 7/19 (37%)
leucine-rich repeat 471..494 CDD:275380 7/22 (32%)
LRRCT 503..554 CDD:214507 16/52 (31%)
rtn4rl2aNP_982346.1 leucine-rich repeat 53..70 CDD:275380 4/26 (15%)
LRR_8 73..127 CDD:290566 17/58 (29%)
leucine-rich repeat 73..93 CDD:275380 6/19 (32%)
LRR_RI 94..>329 CDD:238064 73/242 (30%)
leucine-rich repeat 95..117 CDD:275380 6/26 (23%)
leucine-rich repeat 118..142 CDD:275380 8/23 (35%)
leucine-rich repeat 143..166 CDD:275380 4/22 (18%)
LRR_8 166..225 CDD:290566 23/58 (40%)
leucine-rich repeat 167..190 CDD:275380 8/22 (36%)
leucine-rich repeat 191..214 CDD:275380 9/22 (41%)
LRR_8 214..272 CDD:290566 19/57 (33%)
leucine-rich repeat 215..238 CDD:275380 9/22 (41%)
leucine-rich repeat 239..262 CDD:275380 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.