DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and CG4950

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001261934.1 Gene:CG4950 / 39783 FlyBaseID:FBgn0036587 Length:574 Species:Drosophila melanogaster


Alignment Length:324 Identity:89/324 - (27%)
Similarity:157/324 - (48%) Gaps:20/324 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 NLKSVPVTQVIPMN-MVNIDLSRNILSTLHKDTFRGLTVLKELDISHNVLDFLPFDLFQDLDSLL 232
            ||.|:..:..|..| ::.:|||.|.:|:|..:.|.||..:.::.::.|:|..|..|:|:|.:.|.
  Fly   129 NLTSIQTSVFIGANVLMRLDLSYNEISSLSVNAFCGLHTISQIYLTGNLLKELHNDIFKDNEYLE 193

  Fly   233 VLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIGMLPESIFYHAQRLTVINMCDNQIQNFPPNLL 297
            .:..:.|.|..|....|..:|.:..::||.|.:..:....|..|..|..:.:..|:::||.   |
  Fly   194 KVSFEGNLLTSIQPEVFRNMRRIKEVNLSNNRLIFIHPDTFADAASLENLVLSYNELKNFQ---L 255

  Fly   298 RDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRIS 362
            .::.::.:|.:..|.::.|:..:.|::..      ..|||:::   |......:.||.|..|::|
  Fly   256 TEKNIVHQLHLDNNYLTNLTINATRFVRA------SHNQISEL---FLHQSLHIETLDLSANKLS 311

  Fly   363 SLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFLNVSALTRLT 427
            |:|.  ..|:.:::.||::.|.|..::.:.|.:|..|..|.|....:..:...:|.....|..|.
  Fly   312 SISN--ITNITHMLYLDVSDNPIGPLNISTFSQLKRLRGLNLRGTGIRELKFGMFSKQKYLEELD 374

  Fly   428 LFSNNLTTLEADDF-QGLNNLKILLLNNNILKNFDA-RAF-EPLSQLEKLRIDSNKL--MFLPH 486
            |..||||.|..|.| ..|.|||..|::.|.|..... |.| |...||:||.:..|:.  .:|.|
  Fly   375 LSFNNLTILNLDMFVPYLTNLKKFLIDGNGLTELQGNRTFSEAFPQLQKLGVSRNRFNCSYLHH 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 18/59 (31%)
leucine-rich repeat 187..206 CDD:275380 9/18 (50%)
LRR_RI <201..386 CDD:238064 44/184 (24%)
leucine-rich repeat 207..230 CDD:275380 6/22 (27%)
leucine-rich repeat 231..254 CDD:275380 5/22 (23%)
LRR_8 253..313 CDD:290566 13/59 (22%)
leucine-rich repeat 255..278 CDD:275380 5/22 (23%)
leucine-rich repeat 279..302 CDD:275380 5/22 (23%)
LRR_8 303..361 CDD:290566 12/57 (21%)
leucine-rich repeat 303..326 CDD:275380 4/22 (18%)
leucine-rich repeat 327..350 CDD:275380 4/22 (18%)
LRR_8 349..407 CDD:290566 17/57 (30%)
LRR_4 350..390 CDD:289563 12/39 (31%)
leucine-rich repeat 351..374 CDD:275380 8/22 (36%)
leucine-rich repeat 375..398 CDD:275380 6/22 (27%)
LRR_8 398..>443 CDD:290566 14/45 (31%)
leucine-rich repeat 399..422 CDD:275380 4/22 (18%)
leucine-rich repeat 423..443 CDD:275380 10/20 (50%)
leucine-rich repeat 471..494 CDD:275380 6/18 (33%)
LRRCT 503..554 CDD:214507
CG4950NP_001261934.1 leucine-rich repeat 96..119 CDD:275380
LRR_8 118..178 CDD:290566 15/48 (31%)
leucine-rich repeat 120..143 CDD:275380 4/13 (31%)
leucine-rich repeat 144..167 CDD:275380 9/22 (41%)
leucine-rich repeat 168..191 CDD:275380 6/22 (27%)
LRR_8 192..250 CDD:290566 13/57 (23%)
leucine-rich repeat 192..215 CDD:275380 5/22 (23%)
LRR_RI <207..432 CDD:238064 63/238 (26%)
leucine-rich repeat 216..239 CDD:275380 5/22 (23%)
leucine-rich repeat 240..299 CDD:275380 13/70 (19%)
LRR_8 299..356 CDD:290566 17/58 (29%)
leucine-rich repeat 300..321 CDD:275380 8/22 (36%)
leucine-rich repeat 322..345 CDD:275380 6/22 (27%)
LRR_8 344..405 CDD:290566 20/60 (33%)
leucine-rich repeat 346..365 CDD:275380 3/18 (17%)
leucine-rich repeat 370..394 CDD:275380 11/23 (48%)
leucine-rich repeat 395..420 CDD:275380 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.