DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and Toll-6

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001246765.1 Gene:Toll-6 / 39663 FlyBaseID:FBgn0036494 Length:1514 Species:Drosophila melanogaster


Alignment Length:569 Identity:143/569 - (25%)
Similarity:246/569 - (43%) Gaps:136/569 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 CSLNACESLGIVSQLLMLINSM---------PNG-TQSAANDKKPPKSKAN-------------G 95
            |:|:...:|.:....|..:|.:         .|| |:|.:..:...||.::             .
  Fly   221 CTLSELSALNMSENRLQDVNELGFRDRSKEPTNGSTESTSTTESAKKSSSSSTSCSLDLEYLDVS 285

  Fly    96 HNDG-----------------DVNGGEIN-----AMSHLANFDLVKRVRQIESRLRSVEQPVWHL 138
            |||.                 .||...|:     |:|.|.|..::..     |..:.|..|....
  Fly   286 HNDFVVLPANGFGTLRRLRVLSVNNNGISMIADKALSGLKNLQILNL-----SSNKIVALPTELF 345

  Fly   139 ATGSQI--EWNHCTSGVCRCNPDTKSFTCWNTNLKSVPVTQVIPMNMVNIDLSRN-ILST-LHKD 199
            |..::|  |.....:.:...||...|      ||..:..          :|||.| |.|| :.|:
  Fly   346 AEQAKIIQEVYLQNNSISVLNPQLFS------NLDQLQA----------LDLSMNQITSTWIDKN 394

  Fly   200 TFRGLTVLKELDISHNVLDFLPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNE 264
            ||.||..|..|::|||.|..|..::|.||.:|.:|.:::||||:|...||..:.||:.|.||.|:
  Fly   395 TFVGLIRLVLLNLSHNKLTKLEPEIFSDLYTLQILNLRHNQLENIAADTFAPMNNLHTLLLSHNK 459

  Fly   265 IGMLPESIFYHAQRLTVINMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKT 329
            :..|..........|:::::.:|.:....|:..|:...|::|:::.|::..:.. ::|.:..|:|
  Fly   460 LKYLDAYALNGLYVLSLLSLDNNALIGVHPDAFRNCSALQDLNLNGNQLKTVPL-ALRNMRHLRT 523

  Fly   330 LDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFV 394
            :|.|.|.|..::|..|.||.:|..|.|..|.:.:::...|.:|.||..|:|..|||:.::..||.
  Fly   524 VDLGENMITVMEDSAFKGLGNLYGLRLIGNYLENITMHTFRDLPNLQILNLARNRIAVVEPGAFE 588

  Fly   395 -------------ELNNLNELFLGQNSMSSIPADLFLNV--------------SALTRLTLFSNN 432
                         |||::|.||      |::|:.|:||:              |.|..|.|..|.
  Fly   589 MTSSIQAVRLDGNELNDINGLF------SNMPSLLWLNISDNRLESFDYGHVPSTLQWLDLHKNR 647

  Fly   433 LTTLEADDFQGL-------------------------NNLKILLLNNNILKNFDARAFEPLSQLE 472
            |::| ::.| ||                         |::::|.||:|::...|...|...:.|.
  Fly   648 LSSL-SNRF-GLDSELKLQTLDVSFNQLQRIGPSSIPNSIELLFLNDNLITTVDPDTFMHKTNLT 710

  Fly   473 KLRIDSNKLMFLPHGALHGL-----KNLVAVKLDKNPWHCDCRALYLAR 516
            ::.:.:|::..|...:|..|     :.|....:..||:.|||...:|.:
  Fly   711 RVDLYANQITTLDIKSLRILPVWEHRALPEFYIGGNPFTCDCNIDWLQK 759

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 25/60 (42%)
leucine-rich repeat 187..206 CDD:275380 12/20 (60%)
LRR_RI <201..386 CDD:238064 59/184 (32%)
leucine-rich repeat 207..230 CDD:275380 10/22 (45%)
leucine-rich repeat 231..254 CDD:275380 9/22 (41%)
LRR_8 253..313 CDD:290566 14/59 (24%)
leucine-rich repeat 255..278 CDD:275380 6/22 (27%)
leucine-rich repeat 279..302 CDD:275380 4/22 (18%)
LRR_8 303..361 CDD:290566 18/57 (32%)
leucine-rich repeat 303..326 CDD:275380 4/22 (18%)
leucine-rich repeat 327..350 CDD:275380 10/22 (45%)
LRR_8 349..407 CDD:290566 21/70 (30%)
LRR_4 350..390 CDD:289563 13/39 (33%)
leucine-rich repeat 351..374 CDD:275380 6/22 (27%)
leucine-rich repeat 375..398 CDD:275380 10/35 (29%)
LRR_8 398..>443 CDD:290566 16/58 (28%)
leucine-rich repeat 399..422 CDD:275380 8/36 (22%)
leucine-rich repeat 423..443 CDD:275380 7/19 (37%)
leucine-rich repeat 471..494 CDD:275380 5/27 (19%)
LRRCT 503..554 CDD:214507 6/14 (43%)
Toll-6NP_001246765.1 leucine-rich repeat 148..171 CDD:275380
LRR_8 171..236 CDD:290566 3/14 (21%)
leucine-rich repeat 172..201 CDD:275380
leucine-rich repeat 202..278 CDD:275380 11/56 (20%)
leucine-rich repeat 229..249 CDD:275380 3/19 (16%)
LRR_RI 278..468 CDD:238064 59/210 (28%)
leucine-rich repeat 279..302 CDD:275380 3/22 (14%)
LRR_8 301..386 CDD:290566 22/105 (21%)
leucine-rich repeat 303..326 CDD:275380 6/22 (27%)
leucine-rich repeat 327..350 CDD:275380 4/27 (15%)
LRR 350..729 CDD:227223 110/403 (27%)
leucine-rich repeat 352..375 CDD:275380 6/28 (21%)
leucine-rich repeat 376..401 CDD:275380 12/34 (35%)
LRR_RI <401..626 CDD:238064 70/231 (30%)
leucine-rich repeat 402..425 CDD:275380 10/22 (45%)
leucine-rich repeat 426..449 CDD:275380 9/22 (41%)
leucine-rich repeat 450..473 CDD:275380 6/22 (27%)
leucine-rich repeat 474..497 CDD:275380 4/22 (18%)
leucine-rich repeat 498..518 CDD:275380 4/20 (20%)
leucine-rich repeat 521..544 CDD:275380 10/22 (45%)
leucine-rich repeat 545..566 CDD:275380 5/20 (25%)
leucine-rich repeat 569..592 CDD:275380 8/22 (36%)
leucine-rich repeat 593..615 CDD:275380 7/27 (26%)
leucine-rich repeat 616..637 CDD:275380 3/20 (15%)
leucine-rich repeat 638..662 CDD:275380 9/25 (36%)
leucine-rich repeat 663..684 CDD:275380 0/20 (0%)
leucine-rich repeat 685..708 CDD:275380 6/22 (27%)
leucine-rich repeat 709..728 CDD:275380 3/18 (17%)
LRR_8 883..943 CDD:290566
leucine-rich repeat 885..908 CDD:275380
leucine-rich repeat 909..932 CDD:275380
LRR_8 932..990 CDD:290566
leucine-rich repeat 933..956 CDD:275380
TIR 1114..1247 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40411
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.