DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and Toll-7

DIOPT Version :10

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster


Alignment Length:465 Identity:118/465 - (25%)
Similarity:217/465 - (46%) Gaps:27/465 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NCSL-----NACESLGIVSQLLMLINSM---PNGTQSAANDKKPPKSKANGHNDGDVNGGEINA- 108
            :|.|     ||.|.|..:..|.:..::.   |..|.....|......:....:.||.|..::.: 
  Fly   143 SCKLLQLPNNAFEGLATLKSLRLSTHNSEWGPTRTLELFPDSLGGLKQLTDLDLGDNNLRQLPSG 207

  Fly   109 -MSHLANFDLVKRVRQIESRLRSVEQPVWHLATGSQIEWNHCTSGVCRCNPDTKSFTCWNTNLKS 172
             :..:.|..::...|   :|:|:.||..:       .:.| |.:|......:.:.....:..|:|
  Fly   208 FLCPVGNLQVLNLTR---NRIRTAEQMGF-------ADMN-CGAGSGSAGSELQVLDASHNELRS 261

  Fly   173 VPVTQVIP--MNMVNIDLSRNILSTLHKDTFRGLTVLKELDISHNVLDFLPFDLFQDLDSLLVLR 235
            :..:..|.  ..:.:::|:.|.||.|..:...||..|:.:::|:|.|:.||..||.....|..:.
  Fly   262 ISESWGISRLRRLQHLNLAYNNLSELSGEALAGLASLRIVNLSNNHLETLPEGLFAGSKELREIH 326

  Fly   236 IQNNQLEDIDHRTFWKLRNLNILDLSKNEI--GMLPESIFYHAQRLTVINMCDNQIQNFPPNLLR 298
            :|.|:|.::....|.:|..|.::|||.|::  ..:..:.|....||.|:|:..|.:........:
  Fly   327 LQQNELYELPKGLFHRLEQLLVVDLSGNQLTSNHVDNTTFAGLIRLIVLNLAHNALTRIDYRTFK 391

  Fly   299 DQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRISS 363
            :...|:.|::..|.|..:...:...|..|.||:...|::..:||..|.||..|..|:|:||.||.
  Fly   392 ELYFLQILNLRNNSIGHIEDNAFLPLYNLHTLNLAENRLHTLDDKLFNGLYVLSKLTLNNNLISV 456

  Fly   364 LSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFLNVSALTRLTL 428
            :...:|.|.::|..|||::|:::.:. .|..:|..|..|.||:|.:.:.....|.|:..||.|.|
  Fly   457 VEPAVFKNCSDLKELDLSSNQLNEVP-RALQDLAMLRTLDLGENQIRTFDNQSFKNLHQLTGLRL 520

  Fly   429 FSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFLPHGALHGLK 493
            ..|.:..:....||.|..|.:|.|..|.:::.:..:|:...:||.:|:|.|.|..: :|....|.
  Fly   521 IDNQIGNITVGMFQDLPRLSVLNLAKNRIQSIERGSFDKNFELEAIRLDRNFLADI-NGVFATLV 584

  Fly   494 NLVAVKLDKN 503
            :|:.:.|.:|
  Fly   585 SLLWLNLSEN 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR 185..>437 CDD:443914 74/253 (29%)
leucine-rich repeat 187..206 CDD:275380 7/18 (39%)
leucine-rich repeat 207..230 CDD:275380 8/22 (36%)
leucine-rich repeat 231..254 CDD:275380 6/22 (27%)
leucine-rich repeat 255..278 CDD:275380 6/24 (25%)
leucine-rich repeat 279..302 CDD:275380 4/22 (18%)
leucine-rich repeat 303..326 CDD:275380 5/22 (23%)
leucine-rich repeat 327..350 CDD:275380 9/22 (41%)
leucine-rich repeat 351..374 CDD:275380 9/22 (41%)
leucine-rich repeat 375..398 CDD:275380 7/22 (32%)
leucine-rich repeat 399..422 CDD:275380 7/22 (32%)
leucine-rich repeat 423..443 CDD:275380 6/19 (32%)
leucine-rich repeat 471..494 CDD:275380 8/22 (36%)
PCC 476..>561 CDD:188093 8/28 (29%)
Toll-7NP_523797.1 LRR 45..473 CDD:443914 82/340 (24%)
leucine-rich repeat 136..159 CDD:275380 6/15 (40%)
leucine-rich repeat 160..190 CDD:275380 4/29 (14%)
leucine-rich repeat 191..214 CDD:275380 3/22 (14%)
leucine-rich repeat 215..248 CDD:275380 8/43 (19%)
leucine-rich repeat 249..273 CDD:275380 3/23 (13%)
leucine-rich repeat 274..297 CDD:275380 7/22 (32%)
leucine-rich repeat 298..321 CDD:275380 8/22 (36%)
leucine-rich repeat 322..345 CDD:275380 6/22 (27%)
leucine-rich repeat 346..371 CDD:275380 6/24 (25%)
LRR 369..>675 CDD:443914 66/228 (29%)
leucine-rich repeat 372..395 CDD:275380 4/22 (18%)
leucine-rich repeat 396..419 CDD:275380 5/22 (23%)
leucine-rich repeat 420..443 CDD:275380 9/22 (41%)
leucine-rich repeat 444..467 CDD:275380 9/22 (41%)
leucine-rich repeat 468..488 CDD:275380 6/20 (30%)
leucine-rich repeat 491..514 CDD:275380 7/22 (32%)
leucine-rich repeat 515..536 CDD:275380 7/20 (35%)
leucine-rich repeat 539..562 CDD:275380 5/22 (23%)
leucine-rich repeat 563..585 CDD:275380 8/22 (36%)
leucine-rich repeat 586..626 CDD:275380 3/9 (33%)
leucine-rich repeat 627..653 CDD:275380
LRRCT 716..772 CDD:214507
LRR <812..>963 CDD:443914
leucine-rich repeat 812..829 CDD:275380
leucine-rich repeat 833..854 CDD:275380
leucine-rich repeat 855..878 CDD:275380
leucine-rich repeat 879..902 CDD:275380
leucine-rich repeat 903..926 CDD:275380
leucine-rich repeat 927..953 CDD:275380
TIR 1098..1235 CDD:214587
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.