DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and lbk

DIOPT Version :10

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster


Alignment Length:737 Identity:166/737 - (22%)
Similarity:283/737 - (38%) Gaps:208/737 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SSDTR---NCSLNACESLGIVSQLL----MLINSMPNGTQSAANDKKPPKSKANG-HNDGDVNGG 104
            :|::|   ||:.:.......:::||    ||:.:.....||||  :.|..|..|| ...|...|.
  Fly    65 ASESRSNDNCNYSTTNDFNKINKLLLITYMLLITAATICQSAA--QSPSSSNGNGVGGSGSTGGS 127

  Fly   105 EINAM--SHLANFDLVKRVRQI------------------------------------------- 124
            .::|:  |..|:::.....:|:                                           
  Fly   128 PLSALLKSGGASYNQQLPQQQLFAMLTRNGGGSSGPRSSGGNRGYTSARQHFMALSEDYSDADVD 192

  Fly   125 ESRLRSVEQPVWHLATGSQIEWNHCTSGV------------------------------------ 153
            |..:.::..|:......:.::.:..:||:                                    
  Fly   193 EEDMAALHYPLSASHPPAGVQGSSSSSGISIQSGSLETNGFVADDGGQYEHAQKALEAAAAAAKA 257

  Fly   154 -----CRCNPDTKS----FTCWNTNLKSVPV-----------------TQVIP----MNMVNIDL 188
                 ..|..|.|.    |.|...:|:.|||                 |.|:.    :|:..:.|
  Fly   258 SNKYNIDCPKDCKCLNVLFDCDKLHLERVPVLPSYVQTLHLANNKLNDTTVLEIRNLLNLTKVSL 322

  Fly   189 SRNILSTLHK----------------------DTFRGLTVLKELDISHNVLDFLPFDLFQDLDSL 231
            .||:|..:.|                      ::...|.:|:.||:|.|.|..:..:.|...::|
  Fly   323 KRNLLEVIPKFIGLSGLKHLVLANNHITSISSESLAALPLLRTLDLSRNKLHTIELNSFPKSNNL 387

  Fly   232 LVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIGMLPESIFYHAQRLTVINMCDNQIQ-NFP-- 293
            :.|.:..|::.:::..:|..|.||..|:||.|.:..||..:|.:..:|..:.:..||:: |:.  
  Fly   388 VHLILSFNEITNVNEHSFATLNNLTDLELSNNRLSTLPIRVFKNLNQLKKLALNFNQLEINWSTF 452

  Fly   294 ------PNL---------LRDQLM-----LEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIA 338
                  .||         |:|.:.     :|.:|::.|:||.||...:..||||:.|:..:|.|:
  Fly   453 RGLESMKNLQLKSNKIRALQDGVFYVMHKIETIDLAMNQISSLSRQGLFNLTKLRHLNLSFNAIS 517

  Fly   339 KIDDDFFAGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELF 403
            :|:.|.:...:||..|.|.||.|:.......:.|..|.||:|..||:.::..|.|..:.||.||.
  Fly   518 RIEVDTWEFTQSLEVLDLSNNAINEFKPQHLDCLHRLKTLNLAHNRLQYLQENTFDCVKNLEELN 582

  Fly   404 LGQNSMSSIPADL-----FLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDAR 463
            |.:|.:|.|..|.     |..:..|.||.|..|||..:......|||||:||.|.:|.|.:....
  Fly   583 LRRNRLSWIIEDQSAAAPFKGLRKLRRLDLHGNNLKQISTKAMSGLNNLEILNLGSNALASIQVN 647

  Fly   464 AFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWDG 528
            |||.:.:|       |||:|         |:|..:        |||..::..:|::....:  ..
  Fly   648 AFEHMLRL-------NKLVF---------KSLNFI--------CDCDLVWFQQWLKNRFPQ--QA 686

  Fly   529 QQPMCRGPGDLGGHEVGLLRYDDLCDGQWASMLSLSPRLPVRKHQISTPMNYTDYFNLYLKHIYN 593
            :..:|..|..|....:..|...:|     ..:.|..||:    .|....|...:..|:.|:.|.:
  Fly   687 EHAVCGYPEHLLDRHLKSLSSSEL-----VCVDSPKPRV----EQEPDDMLAVNAANITLECIAS 742

  Fly   594 GTTDEELKEADITSVSIKKVHN 615
            ..|...|..||  .:.||..|:
  Fly   743 SPTAASLAAAD--ELKIKWRHD 762

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR 185..>437 CDD:443914 84/301 (28%)
leucine-rich repeat 187..206 CDD:275380 6/40 (15%)
leucine-rich repeat 207..230 CDD:275380 7/22 (32%)
leucine-rich repeat 231..254 CDD:275380 5/22 (23%)
leucine-rich repeat 255..278 CDD:275380 8/22 (36%)
leucine-rich repeat 279..302 CDD:275380 8/40 (20%)
leucine-rich repeat 303..326 CDD:275380 8/22 (36%)
leucine-rich repeat 327..350 CDD:275380 6/22 (27%)
leucine-rich repeat 351..374 CDD:275380 7/22 (32%)
leucine-rich repeat 375..398 CDD:275380 8/22 (36%)
leucine-rich repeat 399..422 CDD:275380 9/27 (33%)
leucine-rich repeat 423..443 CDD:275380 7/19 (37%)
leucine-rich repeat 471..494 CDD:275380 5/22 (23%)
PCC 476..>561 CDD:188093 15/84 (18%)
lbkNP_611091.2 LRR <293..642 CDD:443914 96/348 (28%)
leucine-rich repeat 293..316 CDD:275380 2/22 (9%)
leucine-rich repeat 317..338 CDD:275380 5/20 (25%)
leucine-rich repeat 339..362 CDD:275380 1/22 (5%)
leucine-rich repeat 363..386 CDD:275380 7/22 (32%)
leucine-rich repeat 387..410 CDD:275380 5/22 (23%)
leucine-rich repeat 411..434 CDD:275380 8/22 (36%)
leucine-rich repeat 435..457 CDD:275380 4/21 (19%)
leucine-rich repeat 458..481 CDD:275380 4/22 (18%)
leucine-rich repeat 482..505 CDD:275380 8/22 (36%)
leucine-rich repeat 506..529 CDD:275380 6/22 (27%)
leucine-rich repeat 530..553 CDD:275380 7/22 (32%)
leucine-rich repeat 554..577 CDD:275380 8/22 (36%)
leucine-rich repeat 578..604 CDD:275380 9/25 (36%)
leucine-rich repeat 607..630 CDD:275380 9/22 (41%)
leucine-rich repeat 631..652 CDD:275380 9/20 (45%)
LRRCT 665..712 CDD:214507 9/61 (15%)
Ig_3 717..816 CDD:464046 14/52 (27%)
Ig 835..924 CDD:472250
Ig strand B 851..855 CDD:409353
Ig strand C 864..868 CDD:409353
Ig strand E 890..894 CDD:409353
Ig strand F 904..909 CDD:409353
Ig strand G 917..920 CDD:409353
Ig_3 927..1013 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.