| Sequence 1: | NP_647931.1 | Gene: | CG7509 / 38579 | FlyBaseID: | FBgn0035575 | Length: | 615 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038939951.1 | Gene: | Lrg1 / 367455 | RGDID: | 1359464 | Length: | 342 | Species: | Rattus norvegicus |
| Alignment Length: | 256 | Identity: | 77/256 - (30%) |
|---|---|---|---|
| Similarity: | 109/256 - (42%) | Gaps: | 11/256 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 303 LEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLSGT 367
Fly 368 IFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNN 432
Fly 433 LTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLV- 496
Fly 497 ----AVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQPMCRGPGDLGGH------EVGLL 547 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7509 | NP_647931.1 | LRR_8 | 182..241 | CDD:290566 | |
| leucine-rich repeat | 187..206 | CDD:275380 | |||
| LRR_RI | <201..386 | CDD:238064 | 27/82 (33%) | ||
| leucine-rich repeat | 207..230 | CDD:275380 | |||
| leucine-rich repeat | 231..254 | CDD:275380 | |||
| LRR_8 | 253..313 | CDD:290566 | 5/9 (56%) | ||
| leucine-rich repeat | 255..278 | CDD:275380 | |||
| leucine-rich repeat | 279..302 | CDD:275380 | |||
| LRR_8 | 303..361 | CDD:290566 | 19/57 (33%) | ||
| leucine-rich repeat | 303..326 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 327..350 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 349..407 | CDD:290566 | 18/57 (32%) | ||
| LRR_4 | 350..390 | CDD:289563 | 13/39 (33%) | ||
| leucine-rich repeat | 351..374 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 375..398 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 398..>443 | CDD:290566 | 16/44 (36%) | ||
| leucine-rich repeat | 399..422 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 423..443 | CDD:275380 | 9/19 (47%) | ||
| leucine-rich repeat | 471..494 | CDD:275380 | 7/22 (32%) | ||
| LRRCT | 503..554 | CDD:214507 | 16/51 (31%) | ||
| Lrg1 | XP_038939951.1 | PRK15370 | <55..>293 | CDD:185268 | 61/205 (30%) |
| leucine-rich repeat | 65..86 | CDD:275380 | |||
| leucine-rich repeat | 87..110 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 111..134 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 135..158 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 159..182 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 183..206 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 207..230 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 231..254 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 255..278 | CDD:275380 | 7/22 (32%) | ||
| PCC | 259..>339 | CDD:188093 | 18/79 (23%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C166334960 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.840 | |||||