DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and Lgi4

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_955793.1 Gene:Lgi4 / 361549 RGDID:735035 Length:537 Species:Rattus norvegicus


Alignment Length:141 Identity:46/141 - (32%)
Similarity:67/141 - (47%) Gaps:3/141 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   399 LNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDAR 463
            |..|.|.:..:|.:.|..||.:.:|..|...||..:.:|.|.|.||:.|:.|.:.:|.:.:....
  Rat    54 LLSLSLVRMGVSRLKAGSFLKMPSLHLLLFTSNTFSVIEGDAFIGLSYLQYLFIEDNKIGSISKN 118

  Fly   464 AFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWDG 528
            |...|..|..|.:.:|.|..||.....||:.|..|.|..||:.||||.|:|.:|:......:..|
  Rat   119 ALRGLRSLTHLSLANNHLEALPRFLFQGLETLTHVDLRGNPFQCDCRVLWLLQWMPMVNASVGTG 183

  Fly   529 QQPMCRGPGDL 539
               .|.||..|
  Rat   184 ---ACAGPSAL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566
leucine-rich repeat 187..206 CDD:275380
LRR_RI <201..386 CDD:238064
leucine-rich repeat 207..230 CDD:275380
leucine-rich repeat 231..254 CDD:275380
LRR_8 253..313 CDD:290566
leucine-rich repeat 255..278 CDD:275380
leucine-rich repeat 279..302 CDD:275380
LRR_8 303..361 CDD:290566
leucine-rich repeat 303..326 CDD:275380
leucine-rich repeat 327..350 CDD:275380
LRR_8 349..407 CDD:290566 3/7 (43%)
LRR_4 350..390 CDD:289563
leucine-rich repeat 351..374 CDD:275380
leucine-rich repeat 375..398 CDD:275380
LRR_8 398..>443 CDD:290566 14/43 (33%)
leucine-rich repeat 399..422 CDD:275380 7/22 (32%)
leucine-rich repeat 423..443 CDD:275380 7/19 (37%)
leucine-rich repeat 471..494 CDD:275380 8/22 (36%)
LRRCT 503..554 CDD:214507 14/37 (38%)
Lgi4NP_955793.1 leucine-rich repeat 54..77 CDD:275378 7/22 (32%)
LRR_8 76..136 CDD:290566 17/59 (29%)
leucine-rich repeat 78..101 CDD:275378 9/22 (41%)
LRR_4 102..140 CDD:289563 9/37 (24%)
leucine-rich repeat 102..125 CDD:275378 5/22 (23%)
leucine-rich repeat 126..149 CDD:275378 8/22 (36%)
leucine-rich repeat 150..162 CDD:275378 5/11 (45%)
LRRCT 158..207 CDD:214507 14/37 (38%)
EPTP <220..251 CDD:281697
EPTP 351..392 CDD:281697
EPTP 396..438 CDD:281697
EPTP 441..482 CDD:281697
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334966
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.