DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and Slit2

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_017454764.1 Gene:Slit2 / 360272 RGDID:69310 Length:1542 Species:Rattus norvegicus


Alignment Length:476 Identity:113/476 - (23%)
Similarity:183/476 - (38%) Gaps:112/476 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 CRCNPDTKSFTCWNTNLKSVPVTQVIPMNMVNIDLSRNILSTLHKDTFRGLTVLKELDISHNVLD 218
            |.|:..|  ..|....|:|||  :.||.|...:||:.|.::.:.|..|.||..|:          
  Rat    32 CSCSGST--VDCHGLALRSVP--RNIPRNTERLDLNGNNITRITKTDFAGLRHLR---------- 82

  Fly   219 FLPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIGMLPESIFYHAQRLTVIN 283
                          ||::..|::..|:...|..|:.|..|.|::|.:.:.||.:|....:|..::
  Rat    83 --------------VLQLMENKISTIERGAFQDLKELERLRLNRNNLQLFPELLFLGTAKLYRLD 133

  Fly   284 MCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGL 348
            :.:||||..|....|..:.::.|.:..|:||.:..|:.|.|..|:.|....|.|.::....|..:
  Rat   134 LSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHM 198

  Fly   349 RSLRTLSLHNNRI----------------------------SSLSG------------------- 366
            ..|||..||:|.:                            |.|.|                   
  Rat   199 PKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLYTQCMGPSHLRGHNVAEVQKREFVCSDEEEG 263

  Fly   367 ------------------TIFNNLAN----------------LVTLDLTTNRISHIDGNAFVELN 397
                              |..||:.:                :..:.|..|.|..|...||....
  Rat   264 HQSFMAPSCSVLHCPIACTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNSIRVIPPGAFSPYK 328

  Fly   398 NLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDA 462
            .|..|.|..|.:|.:..|.|..:.:|..|.|:.|.:|.|....|:||.:|::||||.|.:.....
  Rat   329 KLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRV 393

  Fly   463 RAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWD 527
            .||:.|..|..|.:..|||..:..|....|:.:..:.|.:||:.|||...:||.::....::...
  Rat   394 DAFQDLHNLNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSG 458

  Fly   528 GQQPMCRGPGDLGGHEVGLLR 548
            .:   |..|..|....:|.::
  Rat   459 AR---CTSPRRLANKRIGQIK 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 12/58 (21%)
leucine-rich repeat 187..206 CDD:275380 7/18 (39%)
LRR_RI <201..386 CDD:238064 50/265 (19%)
leucine-rich repeat 207..230 CDD:275380 1/22 (5%)
leucine-rich repeat 231..254 CDD:275380 6/22 (27%)
LRR_8 253..313 CDD:290566 16/59 (27%)
leucine-rich repeat 255..278 CDD:275380 7/22 (32%)
leucine-rich repeat 279..302 CDD:275380 7/22 (32%)
LRR_8 303..361 CDD:290566 18/57 (32%)
leucine-rich repeat 303..326 CDD:275380 7/22 (32%)
leucine-rich repeat 327..350 CDD:275380 5/22 (23%)
LRR_8 349..407 CDD:290566 21/138 (15%)
LRR_4 350..390 CDD:289563 16/120 (13%)
leucine-rich repeat 351..374 CDD:275380 12/87 (14%)
leucine-rich repeat 375..398 CDD:275380 6/22 (27%)
LRR_8 398..>443 CDD:290566 14/44 (32%)
leucine-rich repeat 399..422 CDD:275380 7/22 (32%)
leucine-rich repeat 423..443 CDD:275380 7/19 (37%)
leucine-rich repeat 471..494 CDD:275380 7/22 (32%)
LRRCT 503..554 CDD:214507 11/46 (24%)
Slit2XP_017454764.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.