DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and CG4168

DIOPT Version :10

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_609740.4 Gene:CG4168 / 34889 FlyBaseID:FBgn0028888 Length:1330 Species:Drosophila melanogaster


Alignment Length:141 Identity:30/141 - (21%)
Similarity:49/141 - (34%) Gaps:44/141 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IRAASASADFTAKIWNALTGDELHSFEHKHIVR---------ACAFSED----THRLLTGGMEKI 120
            |:..:.:.|....:|||..|      :|:.|.:         |..||.|    ..|.....|:|.
  Fly   391 IKEKALTFDDLDAVWNAQEG------KHEAIAKNVHDLLAKLAWDFSADQLDYLFRCFQTSMQKS 449

  Fly   121 L------RIFDLNRPDAPPKEVGNSPGSIRTVEW--LHSDNTILS---------------SCTDT 162
            .      |:.:|||..|...:.|.....:..:.|  .||.:|.|.               ||:..
  Fly   450 ASRKQRERLLELNRRLAEDDKNGMMAQKVLNMFWNLAHSSDTPLEVLEQALQSHVKILDYSCSQE 514

  Fly   163 GDIR--LWDIR 171
            .|.:  :|.::
  Fly   515 RDAQKSIWLVK 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR 185..>437 CDD:443914
leucine-rich repeat 187..206 CDD:275380
leucine-rich repeat 207..230 CDD:275380
leucine-rich repeat 231..254 CDD:275380
leucine-rich repeat 255..278 CDD:275380
leucine-rich repeat 279..302 CDD:275380
leucine-rich repeat 303..326 CDD:275380
leucine-rich repeat 327..350 CDD:275380
leucine-rich repeat 351..374 CDD:275380
leucine-rich repeat 375..398 CDD:275380
leucine-rich repeat 399..422 CDD:275380
leucine-rich repeat 423..443 CDD:275380
leucine-rich repeat 471..494 CDD:275380
PCC 476..>561 CDD:188093
CG4168NP_609740.4 PRK15370 <69..>353 CDD:185268
leucine-rich repeat 99..118 CDD:275380
leucine-rich repeat 122..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
leucine-rich repeat 195..214 CDD:275380
leucine-rich repeat 215..236 CDD:275380
leucine-rich repeat 266..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..338 CDD:275380
LRR <338..651 CDD:443914 30/141 (21%)
leucine-rich repeat 339..365 CDD:275380
leucine-rich repeat 366..388 CDD:275380
leucine-rich repeat 389..412 CDD:275380 6/26 (23%)
leucine-rich repeat 414..436 CDD:275380 5/21 (24%)
leucine-rich repeat 437..459 CDD:275380 4/21 (19%)
leucine-rich repeat 460..483 CDD:275380 5/22 (23%)
leucine-rich repeat 484..510 CDD:275380 4/25 (16%)
leucine-rich repeat 511..534 CDD:275380 3/15 (20%)
leucine-rich repeat 535..589 CDD:275380
LRR 543..971 CDD:443914
leucine-rich repeat 590..613 CDD:275380
leucine-rich repeat 614..639 CDD:275380
leucine-rich repeat 640..663 CDD:275380
leucine-rich repeat 664..687 CDD:275380
leucine-rich repeat 688..711 CDD:275380
leucine-rich repeat 712..735 CDD:275380
leucine-rich repeat 740..783 CDD:275380
leucine-rich repeat 785..808 CDD:275380
leucine-rich repeat 809..832 CDD:275380
leucine-rich repeat 833..856 CDD:275380
leucine-rich repeat 857..879 CDD:275380
leucine-rich repeat 880..900 CDD:275380
leucine-rich repeat 905..928 CDD:275380
LRR 911..>1203 CDD:443914
leucine-rich repeat 929..952 CDD:275380
leucine-rich repeat 953..977 CDD:275380
leucine-rich repeat 978..1020 CDD:275380
leucine-rich repeat 1045..1068 CDD:275380
leucine-rich repeat 1069..1090 CDD:275380
leucine-rich repeat 1091..1114 CDD:275380
leucine-rich repeat 1115..1161 CDD:275380
leucine-rich repeat 1162..1190 CDD:275380
PCC 1230..>1298 CDD:188093
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.