| Sequence 1: | NP_647931.1 | Gene: | CG7509 / 38579 | FlyBaseID: | FBgn0035575 | Length: | 615 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001260435.1 | Gene: | kek4 / 34718 | FlyBaseID: | FBgn0032484 | Length: | 649 | Species: | Drosophila melanogaster |
| Alignment Length: | 236 | Identity: | 61/236 - (25%) |
|---|---|---|---|
| Similarity: | 105/236 - (44%) | Gaps: | 50/236 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 318 SGSIRYLT-KLKTLDFGWNQIAKIDDDFF--AGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLD 379
Fly 380 LTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGL 444
Fly 445 NNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDC 509
Fly 510 RALYLARWIREFVL-------------------KLWDGQQP 531 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7509 | NP_647931.1 | LRR_8 | 182..241 | CDD:290566 | |
| leucine-rich repeat | 187..206 | CDD:275380 | |||
| LRR_RI | <201..386 | CDD:238064 | 21/70 (30%) | ||
| leucine-rich repeat | 207..230 | CDD:275380 | |||
| leucine-rich repeat | 231..254 | CDD:275380 | |||
| LRR_8 | 253..313 | CDD:290566 | |||
| leucine-rich repeat | 255..278 | CDD:275380 | |||
| leucine-rich repeat | 279..302 | CDD:275380 | |||
| LRR_8 | 303..361 | CDD:290566 | 13/45 (29%) | ||
| leucine-rich repeat | 303..326 | CDD:275380 | 4/8 (50%) | ||
| leucine-rich repeat | 327..350 | CDD:275380 | 6/24 (25%) | ||
| LRR_8 | 349..407 | CDD:290566 | 16/57 (28%) | ||
| LRR_4 | 350..390 | CDD:289563 | 11/39 (28%) | ||
| leucine-rich repeat | 351..374 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 375..398 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 398..>443 | CDD:290566 | 11/44 (25%) | ||
| leucine-rich repeat | 399..422 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 423..443 | CDD:275380 | 6/19 (32%) | ||
| leucine-rich repeat | 471..494 | CDD:275380 | 6/22 (27%) | ||
| LRRCT | 503..554 | CDD:214507 | 12/48 (25%) | ||
| kek4 | NP_001260435.1 | leucine-rich repeat | 75..99 | CDD:275380 | 6/23 (26%) |
| LRR_8 | 99..158 | CDD:290566 | 17/58 (29%) | ||
| leucine-rich repeat | 100..123 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 124..147 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 146..206 | CDD:290566 | 16/73 (22%) | ||
| leucine-rich repeat | 148..171 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 172..195 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 196..219 | CDD:275380 | 10/46 (22%) | ||
| TPKR_C2 | 228..277 | CDD:301599 | 12/48 (25%) | ||
| IG_like | 294..390 | CDD:214653 | |||
| Ig | 296..387 | CDD:143165 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||