DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and kek2

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_523551.1 Gene:kek2 / 34582 FlyBaseID:FBgn0015400 Length:894 Species:Drosophila melanogaster


Alignment Length:305 Identity:81/305 - (26%)
Similarity:145/305 - (47%) Gaps:36/305 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 KTLDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLSGTIF--NNLANLVTLDLTTNRISHIDG 390
            :|::.|..|::.:.:....|   .:.|:...|.:..|....|  .:|.||..:.|:.|::..|..
  Fly    34 QTVECGGQQLSNLPEGMDPG---TQVLNFSGNALQVLQSERFLRMDLLNLQKIYLSRNQLIRIHE 95

  Fly   391 NAFVELNNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNN 455
            .||..|.||.||.|.:|::.::|::.|.:.|:|.||:|..|.:..|:...|:.|:.|..|.|:|.
  Fly    96 KAFRGLTNLVELDLSENALQNVPSETFQDYSSLMRLSLSGNPIRELKTSAFRHLSFLTTLELSNC 160

  Fly   456 ILKNFDARAFEPLSQLEKLRIDSNKLMFLPHGALHGL-KNLVAVKLDKNPWHCDCRALYLARWIR 519
            .::..:..||..:..||.||:|.|::.|:.  ..|.| |:|..:.|..|.|:||||.|.:..|:.
  Fly   161 QVERIENEAFVGMDNLEWLRLDGNRIGFIQ--GTHILPKSLHGISLHSNRWNCDCRLLDIHFWLV 223

  Fly   520 EFVLKLWDGQQPMCRGPGDLGGHEVGLLR---------------YDDLCDGQWASMLSLSPRLPV 569
            .:...|  .::|.|..|..|.|..:..|:               |.::.:|:..|:..|...:|.
  Fly   224 NYNTPL--AEEPKCMEPARLKGQVIKSLQREQLACLPEVSPQSSYTEVSEGRNMSITCLVRAIPE 286

  Fly   570 RK------HQISTPMNYTDYFNLYLKHIYN---GTTDEELKEADI 605
            .|      .|:.:..:..|  ||::.:..:   |.:..|.|.::|
  Fly   287 PKVLWLFNGQVMSNDSLMD--NLHMYYYIDETIGVSGAEEKRSEI 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566
leucine-rich repeat 187..206 CDD:275380
LRR_RI <201..386 CDD:238064 13/59 (22%)
leucine-rich repeat 207..230 CDD:275380
leucine-rich repeat 231..254 CDD:275380
LRR_8 253..313 CDD:290566
leucine-rich repeat 255..278 CDD:275380
leucine-rich repeat 279..302 CDD:275380
LRR_8 303..361 CDD:290566 6/32 (19%)
leucine-rich repeat 303..326 CDD:275380
leucine-rich repeat 327..350 CDD:275380 4/21 (19%)
LRR_8 349..407 CDD:290566 18/59 (31%)
LRR_4 350..390 CDD:289563 10/41 (24%)
leucine-rich repeat 351..374 CDD:275380 5/24 (21%)
leucine-rich repeat 375..398 CDD:275380 7/22 (32%)
LRR_8 398..>443 CDD:290566 16/44 (36%)
leucine-rich repeat 399..422 CDD:275380 7/22 (32%)
leucine-rich repeat 423..443 CDD:275380 7/19 (37%)
leucine-rich repeat 471..494 CDD:275380 9/23 (39%)
LRRCT 503..554 CDD:214507 16/65 (25%)
kek2NP_523551.1 leucine-rich repeat 34..52 CDD:275380 3/17 (18%)
leucine-rich repeat 54..79 CDD:275380 5/24 (21%)
LRR_8 79..138 CDD:290566 22/58 (38%)
LRR_RI <80..187 CDD:238064 36/106 (34%)
leucine-rich repeat 80..103 CDD:275380 7/22 (32%)
leucine-rich repeat 104..127 CDD:275380 7/22 (32%)
LRR_8 126..186 CDD:290566 21/59 (36%)
leucine-rich repeat 128..151 CDD:275380 8/22 (36%)
leucine-rich repeat 152..175 CDD:275380 6/22 (27%)
leucine-rich repeat 176..198 CDD:275380 9/23 (39%)
TPKR_C2 207..256 CDD:301599 15/50 (30%)
I-set 258..361 CDD:254352 14/74 (19%)
Ig_2 263..361 CDD:290606 14/69 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1378
21.910

Return to query results.
Submit another query.