DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and CG8852

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_608790.2 Gene:CG8852 / 33577 FlyBaseID:FBgn0031548 Length:663 Species:Drosophila melanogaster


Alignment Length:519 Identity:114/519 - (21%)
Similarity:196/519 - (37%) Gaps:170/519 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SLNACESLGIVSQLLMLINSMPNGTQSAAND--KKPP---------KSKANGHNDGD------VN 102
            ::..|..|.:|||:|..:.: .....|:||:  ..||         |:.::..:..|      ::
  Fly     9 AMTQCVFLVVVSQILSHVRA-AGDAMSSANESISLPPACVIRATLYKTSSSERSQNDFGLPLAID 72

  Fly   103 GGEINAMSHLANFDL-VKRV---RQIESRLRSVEQPVWHLATGSQIEWNHCTSGVCRCNPDTKSF 163
            ..|.::|. :..||| .:||   |.:.  |...:.|...:::......::|              
  Fly    73 CSENSSMG-MNYFDLGAQRVAGKRHVS--LDGFQTPPLGISSYGLEYLDNC-------------- 120

  Fly   164 TCWNTNLKSVPVTQ--------------VIPMNMVNIDLSRNILSTLHKDTFRGLTVLKELDISH 214
                .:|:||.:.:              :|| |:..:....|.|.||..:|.:.|..||.|.:..
  Fly   121 ----VDLESVEIQRFVGDATLKLSCGGALIP-NLTAVSFRYNELGTLSGETIQDLPHLKILHLQQ 180

  Fly   215 NVLDFLP-FDLFQDLDSL-------LVLRIQN--NQLEDIDHRTFWKLRNLNILDLSKNE---IG 266
            |.|.:|. |....||:.|       ||||...  |||.:        ||.|::.::.|.|   :.
  Fly   181 NSLRYLEYFKEHSDLEELLIQDERDLVLRFNEILNQLPE--------LRRLSLRNVEKIEDQFLR 237

  Fly   267 MLPESIFYHAQRLTVINMCDNQIQNFP--PNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKT 329
            :|||            |:.|..|:|.|  |.:    |.|.|      .:::|.:.:|   |..:.
  Fly   238 ILPE------------NLTDLIIENTPIQPGV----LYLTE------GVAKLVNVTI---TNCQL 277

  Fly   330 LDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFV 394
            ..|.......:|         :..|:|..|.||||:.:..:..:.|:||||:.||:.|::...|.
  Fly   278 KGFALQPAHNLD---------IMYLNLSGNAISSLNISFESGPSTLLTLDLSRNRLEHLNFTWFY 333

  Fly   395 ELNNLNELFLGQNSMSSIPADL--FLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNIL 457
            ...:|..|.|.:|...|:....  |::.:::..:.|.||.|.:....:                 
  Fly   334 RTTSLRSLHLQENHFHSLSLFQLGFISSASIHHIDLRSNELMSFRDTE----------------- 381

  Fly   458 KNFDARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREF 521
             |.|..::.|     :|||                      .:|.|||.|        :|:..|
  Fly   382 -NADLPSWNP-----QLRI----------------------SIDDNPWSC--------QWMLNF 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 22/68 (32%)
leucine-rich repeat 187..206 CDD:275380 6/18 (33%)
LRR_RI <201..386 CDD:238064 54/199 (27%)
leucine-rich repeat 207..230 CDD:275380 9/23 (39%)
leucine-rich repeat 231..254 CDD:275380 9/31 (29%)
LRR_8 253..313 CDD:290566 16/64 (25%)
leucine-rich repeat 255..278 CDD:275380 6/25 (24%)
leucine-rich repeat 279..302 CDD:275380 6/24 (25%)
LRR_8 303..361 CDD:290566 10/57 (18%)
leucine-rich repeat 303..326 CDD:275380 4/22 (18%)
leucine-rich repeat 327..350 CDD:275380 2/22 (9%)
LRR_8 349..407 CDD:290566 19/57 (33%)
LRR_4 350..390 CDD:289563 15/39 (38%)
leucine-rich repeat 351..374 CDD:275380 7/22 (32%)
leucine-rich repeat 375..398 CDD:275380 9/22 (41%)
LRR_8 398..>443 CDD:290566 10/46 (22%)
leucine-rich repeat 399..422 CDD:275380 6/24 (25%)
leucine-rich repeat 423..443 CDD:275380 4/19 (21%)
leucine-rich repeat 471..494 CDD:275380 3/22 (14%)
LRRCT 503..554 CDD:214507 6/19 (32%)
CG8852NP_608790.2 LRR_RI 114..348 CDD:238064 72/294 (24%)
LRR_8 147..213 CDD:290566 22/66 (33%)
leucine-rich repeat 149..172 CDD:275380 6/22 (27%)
leucine-rich repeat 173..194 CDD:275380 7/20 (35%)
leucine-rich repeat 220..242 CDD:275380 8/33 (24%)
leucine-rich repeat 243..266 CDD:275380 8/32 (25%)
leucine-rich repeat 267..287 CDD:275380 4/22 (18%)
leucine-rich repeat 288..313 CDD:275380 8/33 (24%)
LRR_8 291..348 CDD:290566 20/56 (36%)
leucine-rich repeat 314..337 CDD:275380 9/22 (41%)
leucine-rich repeat 364..387 CDD:275378 6/40 (15%)
leucine-rich repeat 392..403 CDD:275378 7/32 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438687
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.