DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and AgaP_AGAP010804

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_554237.3 Gene:AgaP_AGAP010804 / 3291171 VectorBaseID:AGAP010804 Length:452 Species:Anopheles gambiae


Alignment Length:329 Identity:88/329 - (26%)
Similarity:151/329 - (45%) Gaps:44/329 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 LSRNILSTLHKDTFRGLTVLKELDISHNVLDFLPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWKL 252
            |..|:|:||:.:.|.....::.|::..|.:..: ...|:...||.:| :..|:|..||. ..|.:
Mosquito   103 LPNNLLTTLNMEIFNHFGKIQMLEVKQNRIKAV-LGRFESTASLQLL-LSKNKLTSIDF-CGWNV 164

  Fly   253 RNLNILDLSKNEIGMLPESIFYHAQRLTVINMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELS 317
            .|:..|::..||:..:| :...:...||::::..|:|||...:.......|..||:|.|.::.:.
Mosquito   165 SNMTSLEMDYNELTTVP-ACLDNVNSLTLLSIRTNRIQNVAIDSFAKLKRLVTLDVSFNNLTTIM 228

  Fly   318 SGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTLSL--HNNRISSLS--------------- 365
            ..|..|.|.|:.|....|.::::|    ..|.|:.:|.|  ..|.|||:.               
Mosquito   229 LNSPHYPTSLRDLWITGNNLSQLD----LSLVSVPSLELDVRMNCISSMDVDSISPNITKLNMAA 289

  Fly   366 -------GTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFL--NVS 421
                   .||||:...:..|::..|||..:.|. |....:| :|.|.:|.::||.   |.  |||
Mosquito   290 NPIDCSWKTIFNHFGKIQMLEVKQNRIKAVLGR-FESTASL-QLLLSKNKLTSID---FCGWNVS 349

  Fly   422 ALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFL-- 484
            .:|.|.:..|.|||:.| ....:|:|.:|.:..|.::|....:|..|.:|..|.:..|.|..:  
Mosquito   350 N
MTSLEMDYNELTTVPA-CLDNVNSLTLLSIRTNRIQNVAIDSFAKLKRLVTLDVSFNNLTTIML 413

  Fly   485 --PH 486
              ||
Mosquito   414 NSPH 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 13/52 (25%)
leucine-rich repeat 187..206 CDD:275380 6/17 (35%)
LRR_RI <201..386 CDD:238064 50/208 (24%)
leucine-rich repeat 207..230 CDD:275380 3/22 (14%)
leucine-rich repeat 231..254 CDD:275380 7/22 (32%)
LRR_8 253..313 CDD:290566 16/59 (27%)
leucine-rich repeat 255..278 CDD:275380 4/22 (18%)
leucine-rich repeat 279..302 CDD:275380 6/22 (27%)
LRR_8 303..361 CDD:290566 17/59 (29%)
leucine-rich repeat 303..326 CDD:275380 7/22 (32%)
leucine-rich repeat 327..350 CDD:275380 5/22 (23%)
LRR_8 349..407 CDD:290566 20/81 (25%)
LRR_4 350..390 CDD:289563 15/63 (24%)
leucine-rich repeat 351..374 CDD:275380 10/46 (22%)
leucine-rich repeat 375..398 CDD:275380 6/22 (27%)
LRR_8 398..>443 CDD:290566 17/46 (37%)
leucine-rich repeat 399..422 CDD:275380 9/24 (38%)
leucine-rich repeat 423..443 CDD:275380 7/19 (37%)
leucine-rich repeat 471..494 CDD:275380 6/20 (30%)
LRRCT 503..554 CDD:214507
AgaP_AGAP010804XP_554237.3 leucine-rich repeat 71..97 CDD:275380
leucine-rich repeat 98..121 CDD:275380 6/17 (35%)
leucine-rich repeat 122..144 CDD:275380 3/22 (14%)
leucine-rich repeat 145..166 CDD:275380 7/22 (32%)
leucine-rich repeat 167..189 CDD:275380 4/22 (18%)
LRR_8 189..248 CDD:290566 17/58 (29%)
leucine-rich repeat 190..213 CDD:275380 6/22 (27%)
leucine-rich repeat 214..237 CDD:275380 7/22 (32%)
leucine-rich repeat 238..260 CDD:275380 6/25 (24%)
leucine-rich repeat 283..294 CDD:275378 0/10 (0%)
leucine-rich repeat 306..320 CDD:275380 4/13 (31%)
leucine-rich repeat 329..350 CDD:275380 9/24 (38%)
leucine-rich repeat 351..373 CDD:275380 7/22 (32%)
LRR_8 373..432 CDD:290566 12/45 (27%)
leucine-rich repeat 374..397 CDD:275380 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.