Sequence 1: | NP_647931.1 | Gene: | CG7509 / 38579 | FlyBaseID: | FBgn0035575 | Length: | 615 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_564789.2 | Gene: | AgaP_AGAP007470 / 3290374 | VectorBaseID: | AGAP007470 | Length: | 334 | Species: | Anopheles gambiae |
Alignment Length: | 263 | Identity: | 62/263 - (23%) |
---|---|---|---|
Similarity: | 111/263 - (42%) | Gaps: | 46/263 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 278 RLTVINMCDNQIQNF-----PPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQI 337
Fly 338 AKID-----DDFFAGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELN 397
Fly 398 NLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLN--NLKILLLNNNILKNF 460
Fly 461 DARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKL 525
Fly 526 WDG 528 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7509 | NP_647931.1 | LRR_8 | 182..241 | CDD:290566 | |
leucine-rich repeat | 187..206 | CDD:275380 | |||
LRR_RI | <201..386 | CDD:238064 | 30/117 (26%) | ||
leucine-rich repeat | 207..230 | CDD:275380 | |||
leucine-rich repeat | 231..254 | CDD:275380 | |||
LRR_8 | 253..313 | CDD:290566 | 10/39 (26%) | ||
leucine-rich repeat | 255..278 | CDD:275380 | 62/263 (24%) | ||
leucine-rich repeat | 279..302 | CDD:275380 | 7/27 (26%) | ||
LRR_8 | 303..361 | CDD:290566 | 14/62 (23%) | ||
leucine-rich repeat | 303..326 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 327..350 | CDD:275380 | 6/27 (22%) | ||
LRR_8 | 349..407 | CDD:290566 | 18/57 (32%) | ||
LRR_4 | 350..390 | CDD:289563 | 13/39 (33%) | ||
leucine-rich repeat | 351..374 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 375..398 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 398..>443 | CDD:290566 | 9/44 (20%) | ||
leucine-rich repeat | 399..422 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 423..443 | CDD:275380 | 4/19 (21%) | ||
leucine-rich repeat | 471..494 | CDD:275380 | 2/22 (9%) | ||
LRRCT | 503..554 | CDD:214507 | 8/26 (31%) | ||
AgaP_AGAP007470 | XP_564789.2 | leucine-rich repeat | 59..82 | CDD:275380 | 62/263 (24%) |
leucine-rich repeat | 83..106 | CDD:275380 | 7/25 (28%) | ||
leucine-rich repeat | 107..132 | CDD:275380 | 4/24 (17%) | ||
LRR_8 | 108..172 | CDD:290566 | 14/63 (22%) | ||
leucine-rich repeat | 133..156 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 160..>204 | CDD:290566 | 14/44 (32%) | ||
leucine-rich repeat | 162..184 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 185..208 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 209..232 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 233..255 | CDD:275380 | 6/24 (25%) | ||
leucine-rich repeat | 256..278 | CDD:275380 | 9/30 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |