| Sequence 1: | NP_647931.1 | Gene: | CG7509 / 38579 | FlyBaseID: | FBgn0035575 | Length: | 615 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_556316.2 | Gene: | AgaP_AGAP005667 / 3290019 | VectorBaseID: | AGAP005667 | Length: | 414 | Species: | Anopheles gambiae |
| Alignment Length: | 319 | Identity: | 81/319 - (25%) |
|---|---|---|---|
| Similarity: | 137/319 - (42%) | Gaps: | 61/319 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 233 VLRIQNNQLEDIDHRTF---------------WKLR----------------NLNILDLSKN--- 263
Fly 264 --------EIGMLPESIFYHAQRLTVINMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGS 320
Fly 321 IRY---LTKLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTT 382
Fly 383 NRISHIDGNAFVELNNLNELFLGQNSMSSIP--ADLFLNVSALTRLTLFSNNLTTLEADDFQGLN 445
Fly 446 NLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNK-----LMFLPHGAL--HGLKNLVA 497 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7509 | NP_647931.1 | LRR_8 | 182..241 | CDD:290566 | 4/7 (57%) |
| leucine-rich repeat | 187..206 | CDD:275380 | |||
| LRR_RI | <201..386 | CDD:238064 | 46/197 (23%) | ||
| leucine-rich repeat | 207..230 | CDD:275380 | |||
| leucine-rich repeat | 231..254 | CDD:275380 | 10/51 (20%) | ||
| LRR_8 | 253..313 | CDD:290566 | 18/86 (21%) | ||
| leucine-rich repeat | 255..278 | CDD:275380 | 8/33 (24%) | ||
| leucine-rich repeat | 279..302 | CDD:275380 | 4/22 (18%) | ||
| LRR_8 | 303..361 | CDD:290566 | 16/60 (27%) | ||
| leucine-rich repeat | 303..326 | CDD:275380 | 8/25 (32%) | ||
| leucine-rich repeat | 327..350 | CDD:275380 | 4/22 (18%) | ||
| LRR_8 | 349..407 | CDD:290566 | 16/57 (28%) | ||
| LRR_4 | 350..390 | CDD:289563 | 12/39 (31%) | ||
| leucine-rich repeat | 351..374 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 375..398 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 398..>443 | CDD:290566 | 13/46 (28%) | ||
| leucine-rich repeat | 399..422 | CDD:275380 | 7/24 (29%) | ||
| leucine-rich repeat | 423..443 | CDD:275380 | 5/19 (26%) | ||
| leucine-rich repeat | 471..494 | CDD:275380 | 11/29 (38%) | ||
| LRRCT | 503..554 | CDD:214507 | |||
| AgaP_AGAP005667 | XP_556316.2 | LRR_RI | <87..312 | CDD:238064 | 57/231 (25%) |
| leucine-rich repeat | 110..132 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 133..156 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 157..178 | CDD:275380 | 8/20 (40%) | ||
| LRR_8 | 184..240 | CDD:290566 | 15/57 (26%) | ||
| leucine-rich repeat | 184..207 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 208..229 | CDD:275380 | 8/20 (40%) | ||
| leucine-rich repeat | 230..252 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 253..277 | CDD:275380 | 7/23 (30%) | ||
| leucine-rich repeat | 278..299 | CDD:275380 | 6/23 (26%) | ||
| LRR_8 | 279..334 | CDD:290566 | 18/54 (33%) | ||
| leucine-rich repeat | 300..323 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 324..346 | CDD:275380 | 9/21 (43%) | ||
| leucine-rich repeat | 347..367 | CDD:275380 | 4/11 (36%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||