DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and AgaP_AGAP004913

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_557548.3 Gene:AgaP_AGAP004913 / 3289868 VectorBaseID:AGAP004913 Length:322 Species:Anopheles gambiae


Alignment Length:351 Identity:82/351 - (23%)
Similarity:136/351 - (38%) Gaps:115/351 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 LLVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIGMLPESIFYHAQRLTVINMCDNQIQNFPPN 295
            |..|.|.:::::.:. .|...|..|.:|::||:.|..:..::|....:|..:|:|||:|      
Mosquito    29 LSFLTITDSRMKSVP-ATIAHLVVLKMLEISKSSIETVNLNLFSKLTQLRHLNLCDNKI------ 86

  Fly   296 LLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLHNNR 360
                 |.|...|.:....::||.           |....|.:..||...|:.::.|.||.||:||
Mosquito    87 -----LFLHLSDAAGGNFAQLSD-----------LFLSGNLLTTIDLSGFSNMKVLETLDLHSNR 135

  Fly   361 ISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPA----------- 414
            |..:.|.:..|  ||..|||:.|||..:|...: .:.:||...|..|.:.::|:           
Mosquito   136 IRRVQGALVLN--NLKFLDLSENRIETLDCCEW-NITSLNRFKLSSNELVTLPSCLPMSMPNVNY 197

  Fly   415 -----------DLFLNVSALTR---LTLFSNNLTTLEAD---------DFQGLNNLKIL------ 450
                       ||:.::..|.|   |.:..|.||....|         |.|. ||:|:|      
Mosquito   198 LIFQRNALTDGDLWYSLFTLERLLQLDISYNRLTKAVFDIVSQSLLVLDLQN-NNIKVLSVPAAG 261

  Fly   451 -----LLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDC- 509
                 |.:.|.:..||.::..|                          |:..:::..||  .|| 
Mosquito   262 KGLKVLASFNSIDTFDIKSLSP--------------------------NVTFLEMLGNP--IDCT 298

  Fly   510 --RALYLARWIREFVLKLWDGQQPMC 533
              ||            ::..||:|:|
Mosquito   299 FDRA------------RMRIGQEPVC 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 3/9 (33%)
leucine-rich repeat 187..206 CDD:275380
LRR_RI <201..386 CDD:238064 44/154 (29%)
leucine-rich repeat 207..230 CDD:275380
leucine-rich repeat 231..254 CDD:275380 5/22 (23%)
LRR_8 253..313 CDD:290566 15/59 (25%)
leucine-rich repeat 255..278 CDD:275380 6/22 (27%)
leucine-rich repeat 279..302 CDD:275380 6/22 (27%)
LRR_8 303..361 CDD:290566 15/57 (26%)
leucine-rich repeat 303..326 CDD:275380 4/22 (18%)
leucine-rich repeat 327..350 CDD:275380 5/22 (23%)
LRR_8 349..407 CDD:290566 22/57 (39%)
LRR_4 350..390 CDD:289563 18/39 (46%)
leucine-rich repeat 351..374 CDD:275380 10/22 (45%)
leucine-rich repeat 375..398 CDD:275380 8/22 (36%)
LRR_8 398..>443 CDD:290566 15/78 (19%)
leucine-rich repeat 399..422 CDD:275380 7/44 (16%)
leucine-rich repeat 423..443 CDD:275380 8/31 (26%)
leucine-rich repeat 471..494 CDD:275380 0/22 (0%)
LRRCT 503..554 CDD:214507 10/34 (29%)
AgaP_AGAP004913XP_557548.3 LRR_8 32..86 CDD:290566 15/54 (28%)
leucine-rich repeat 52..75 CDD:275380 6/22 (27%)
LRR_RI <70..244 CDD:238064 50/198 (25%)
LRR_8 74..136 CDD:290566 22/83 (27%)
leucine-rich repeat 76..101 CDD:275380 9/35 (26%)
leucine-rich repeat 102..125 CDD:275380 7/33 (21%)
leucine-rich repeat 126..147 CDD:275380 10/22 (45%)
leucine-rich repeat 148..170 CDD:275380 8/22 (36%)
leucine-rich repeat 171..194 CDD:275380 5/22 (23%)
leucine-rich repeat 195..219 CDD:275380 3/23 (13%)
leucine-rich repeat 220..241 CDD:275380 5/20 (25%)
leucine-rich repeat 242..266 CDD:275380 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.