| Sequence 1: | NP_647931.1 | Gene: | CG7509 / 38579 | FlyBaseID: | FBgn0035575 | Length: | 615 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038948686.1 | Gene: | Adgra3 / 305408 | RGDID: | 1304914 | Length: | 1307 | Species: | Rattus norvegicus |
| Alignment Length: | 231 | Identity: | 58/231 - (25%) |
|---|---|---|---|
| Similarity: | 81/231 - (35%) | Gaps: | 98/231 - (42%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 290 QNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTL 354
Fly 355 SLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFLN 419
Fly 420 VSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFL 484
Fly 485 PHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIRE 520 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7509 | NP_647931.1 | LRR_8 | 182..241 | CDD:290566 | |
| leucine-rich repeat | 187..206 | CDD:275380 | |||
| LRR_RI | <201..386 | CDD:238064 | 40/95 (42%) | ||
| leucine-rich repeat | 207..230 | CDD:275380 | |||
| leucine-rich repeat | 231..254 | CDD:275380 | |||
| LRR_8 | 253..313 | CDD:290566 | 7/22 (32%) | ||
| leucine-rich repeat | 255..278 | CDD:275380 | |||
| leucine-rich repeat | 279..302 | CDD:275380 | 4/11 (36%) | ||
| LRR_8 | 303..361 | CDD:290566 | 26/57 (46%) | ||
| leucine-rich repeat | 303..326 | CDD:275380 | 11/22 (50%) | ||
| leucine-rich repeat | 327..350 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 349..407 | CDD:290566 | 20/57 (35%) | ||
| LRR_4 | 350..390 | CDD:289563 | 16/39 (41%) | ||
| leucine-rich repeat | 351..374 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 375..398 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 398..>443 | CDD:290566 | 0/44 (0%) | ||
| leucine-rich repeat | 399..422 | CDD:275380 | 0/22 (0%) | ||
| leucine-rich repeat | 423..443 | CDD:275380 | 0/19 (0%) | ||
| leucine-rich repeat | 471..494 | CDD:275380 | 3/22 (14%) | ||
| LRRCT | 503..554 | CDD:214507 | 7/18 (39%) | ||
| Adgra3 | XP_038948686.1 | leucine-rich repeat | 69..92 | CDD:275378 | 11/24 (46%) |
| LRR_8 | 71..127 | CDD:404697 | 26/55 (47%) | ||
| leucine-rich repeat | 93..116 | CDD:275378 | 9/22 (41%) | ||
| LRR_8 | 115..168 | CDD:404697 | 25/124 (20%) | ||
| leucine-rich repeat | 117..140 | CDD:275378 | 10/22 (45%) | ||
| PCC | 121..>226 | CDD:188093 | 31/166 (19%) | ||
| leucine-rich repeat | 141..164 | CDD:275378 | 12/94 (13%) | ||
| Ig_3 | 228..310 | CDD:404760 | |||
| HRM | <349..402 | CDD:397086 | |||
| GPS | 685..729 | CDD:396408 | |||
| 7tmB2_GPR125 | 742..1049 | CDD:320665 | |||
| TM helix 1 | 745..769 | CDD:320665 | |||
| TM helix 2 | 781..802 | CDD:320665 | |||
| TM helix 3 | 812..834 | CDD:320665 | |||
| TM helix 4 | 862..878 | CDD:320665 | |||
| TM helix 5 | 899..922 | CDD:320665 | |||
| TM helix 6 | 982..1004 | CDD:320665 | |||
| TM helix 7 | 1011..1036 | CDD:320665 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||