| Sequence 1: | NP_647931.1 | Gene: | CG7509 / 38579 | FlyBaseID: | FBgn0035575 | Length: | 615 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_937893.1 | Gene: | Lrrc4b / 272381 | MGIID: | 3027390 | Length: | 709 | Species: | Mus musculus |
| Alignment Length: | 298 | Identity: | 97/298 - (32%) |
|---|---|---|---|
| Similarity: | 142/298 - (47%) | Gaps: | 27/298 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 261 SKNEIGMLPESIFYHAQRLTVINMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLT 325
Fly 326 KLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDL-TTNRISHID 389
Fly 390 GNAFVELNNLNELFLGQNSMSSIPADLFLNVSALTR---LTLFSNNLTTLEADDFQGLNNLKILL 451
Fly 452 LNNNILKNFDARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLAR 516
Fly 517 WIREFVLKLWDGQQP-------MCRGPGDLGGHEVGLL 547 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7509 | NP_647931.1 | LRR_8 | 182..241 | CDD:290566 | |
| leucine-rich repeat | 187..206 | CDD:275380 | |||
| LRR_RI | <201..386 | CDD:238064 | 37/125 (30%) | ||
| leucine-rich repeat | 207..230 | CDD:275380 | |||
| leucine-rich repeat | 231..254 | CDD:275380 | |||
| LRR_8 | 253..313 | CDD:290566 | 14/51 (27%) | ||
| leucine-rich repeat | 255..278 | CDD:275380 | 4/16 (25%) | ||
| leucine-rich repeat | 279..302 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 303..361 | CDD:290566 | 19/57 (33%) | ||
| leucine-rich repeat | 303..326 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 327..350 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 349..407 | CDD:290566 | 24/58 (41%) | ||
| LRR_4 | 350..390 | CDD:289563 | 16/40 (40%) | ||
| leucine-rich repeat | 351..374 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 375..398 | CDD:275380 | 9/23 (39%) | ||
| LRR_8 | 398..>443 | CDD:290566 | 16/47 (34%) | ||
| leucine-rich repeat | 399..422 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 423..443 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 471..494 | CDD:275380 | 10/22 (45%) | ||
| LRRCT | 503..554 | CDD:214507 | 18/52 (35%) | ||
| Lrrc4b | NP_937893.1 | LRRNT | 59..92 | CDD:214470 | 4/16 (25%) |
| LRR | <89..299 | CDD:227223 | 71/217 (33%) | ||
| LRR 1 | 89..110 | 5/23 (22%) | |||
| leucine-rich repeat | 90..113 | CDD:275380 | 5/25 (20%) | ||
| LRR 2 | 113..134 | 6/20 (30%) | |||
| leucine-rich repeat | 114..137 | CDD:275380 | 7/22 (32%) | ||
| LRR 3 | 137..158 | 5/20 (25%) | |||
| leucine-rich repeat | 138..161 | CDD:275380 | 6/22 (27%) | ||
| LRR 4 | 161..182 | 9/20 (45%) | |||
| leucine-rich repeat | 162..185 | CDD:275380 | 10/22 (45%) | ||
| LRR 5 | 185..207 | 8/21 (38%) | |||
| leucine-rich repeat | 186..210 | CDD:275380 | 9/23 (39%) | ||
| LRR 6 | 210..231 | 9/25 (36%) | |||
| leucine-rich repeat | 211..232 | CDD:275380 | 9/25 (36%) | ||
| LRR 7 | 232..253 | 6/20 (30%) | |||
| leucine-rich repeat | 233..256 | CDD:275380 | 8/22 (36%) | ||
| LRR 8 | 256..277 | 5/20 (25%) | |||
| leucine-rich repeat | 257..280 | CDD:275380 | 6/22 (27%) | ||
| LRR 9 | 280..301 | 9/20 (45%) | |||
| leucine-rich repeat | 281..302 | CDD:275380 | 9/20 (45%) | ||
| LRRCT | 313..363 | CDD:214507 | 18/52 (35%) | ||
| I-set | 366..455 | CDD:400151 | |||
| Ig strand A | 366..369 | CDD:409353 | |||
| Ig strand A' | 373..376 | CDD:409353 | |||
| Ig strand B | 382..389 | CDD:409353 | |||
| Ig strand C | 395..400 | CDD:409353 | |||
| Ig strand C' | 403..405 | CDD:409353 | |||
| Ig strand D | 414..418 | CDD:409353 | |||
| Ig strand E | 421..425 | CDD:409353 | |||
| Ig strand F | 435..442 | CDD:409353 | |||
| Ig strand G | 445..455 | CDD:409353 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 496..552 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||