DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and Lgi1

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_665712.1 Gene:Lgi1 / 252892 RGDID:628742 Length:557 Species:Rattus norvegicus


Alignment Length:400 Identity:76/400 - (19%)
Similarity:116/400 - (28%) Gaps:193/400 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 MCDNQ---IQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFF 345
            :|:|.   .:..||:::       .|...|:..:|:|.||..:...|:.|.|..|....|.||.|
  Rat    54 LCENARSIPRTVPPDVI-------SLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAF 111

  Fly   346 AGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMS 410
            .||..|..|.:.||.|.|:|...|..|.:|:                                  
  Rat   112 IGLPHLEYLFIENNNIKSISRHTFRGLKSLI---------------------------------- 142

  Fly   411 SIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLR 475
                          .|:|.:|||.||..|.|:||::          |.|.|.|.           
  Rat   143 --------------HLSLANNNLQTLPKDIFKGLDS----------LTNVDLRG----------- 172

  Fly   476 IDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQPMCRGPGDLG 540
                                       |.::|||:..:|..|:......:.|   ..|.||.:..
  Rat   173 ---------------------------NSFNCDCKLKWLVEWLGHTNATVED---IYCEGPPEYK 207

  Fly   541 GHEVGLLRYDDLCDGQWASMLSLSPR--------------LPVRKHQIST--------------- 576
            ..::.                ||||:              ||.:...|.|               
  Rat   208 KRKIN----------------SLSPKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPF 256

  Fly   577 ------------PMNYTDYFN-----------------LYL--------KHIY--NGTTDEELKE 602
                        ...:.:|.|                 ||:        .|||  :|..::.:|.
  Rat   257 TGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIDTQLYVIVAQLFGGSHIYKRDGFANKFIKI 321

  Fly   603 ADITSVSIKK 612
            .||..:.|:|
  Rat   322 QDIEVLKIRK 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566
leucine-rich repeat 187..206 CDD:275380
LRR_RI <201..386 CDD:238064 30/104 (29%)
leucine-rich repeat 207..230 CDD:275380
leucine-rich repeat 231..254 CDD:275380
LRR_8 253..313 CDD:290566 6/31 (19%)
leucine-rich repeat 255..278 CDD:275380
leucine-rich repeat 279..302 CDD:275380 4/20 (20%)
LRR_8 303..361 CDD:290566 20/57 (35%)
leucine-rich repeat 303..326 CDD:275380 6/22 (27%)
leucine-rich repeat 327..350 CDD:275380 10/22 (45%)
LRR_8 349..407 CDD:290566 10/57 (18%)
LRR_4 350..390 CDD:289563 10/39 (26%)
leucine-rich repeat 351..374 CDD:275380 9/22 (41%)
leucine-rich repeat 375..398 CDD:275380 1/22 (5%)
LRR_8 398..>443 CDD:290566 9/44 (20%)
leucine-rich repeat 399..422 CDD:275380 0/22 (0%)
leucine-rich repeat 423..443 CDD:275380 9/19 (47%)
leucine-rich repeat 471..494 CDD:275380 0/22 (0%)
LRRCT 503..554 CDD:214507 10/50 (20%)
Lgi1NP_665712.1 leucine-rich repeat 71..92 CDD:275378 6/20 (30%)
LRR_8 91..151 CDD:404697 23/107 (21%)
LRR 1 92..113 8/20 (40%)
leucine-rich repeat 93..116 CDD:275378 10/22 (45%)
LRR 2 116..137 8/20 (40%)
leucine-rich repeat 117..140 CDD:275378 9/22 (41%)
LRR 3 140..161 10/68 (15%)
leucine-rich repeat 141..164 CDD:275378 12/70 (17%)
PCC 146..>221 CDD:188093 28/141 (20%)
leucine-rich repeat 165..177 CDD:275378 5/49 (10%)
EAR 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 225..267 4/41 (10%)
EPTP 225..264 CDD:397689 4/38 (11%)
EAR 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 271..313 7/41 (17%)
EPTP 272..310 CDD:397689 6/37 (16%)
EAR 3. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 317..364 4/14 (29%)
EPTP 317..361 CDD:397689 4/14 (29%)
EAR 4. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 366..415
EAR 5. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 419..462
EPTP 420..459 CDD:397689
EAR 6. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 464..506
EPTP 464..502 CDD:397689
EAR 7. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 510..552
EPTP 510..549 CDD:397689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334968
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.