DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7509 and Lgi2

DIOPT Version :9

Sequence 1:	NP_647931.1	Gene:	CG7509 / 38579	FlyBaseID:	FBgn0035575	Length:	615	Species:	Drosophila melanogaster
Sequence 2:	NP_659194.1	Gene:	Lgi2 / 246316	MGIID:	2180196	Length:	550	Species:	Mus musculus

Alignment Length:	129	Identity:	43/129 - (33%)
Similarity:	64/129 - (49%)	Gaps:	18/129 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   412 IPADLFLNVSALTRLTLFSNNLTTLEADD--FQGLNNLKILLLNNNILKNFDARAFEPLSQLEKL 474
            :|.|    :|:|:.:     |.|.||..|  |..|.:|::||||:|........||..|..||.|
Mouse    56 VPGD----ISSLSLV-----NGTFLEIKDRMFSHLPSLQLLLLNSNSFTVIRDDAFAGLFHLEYL 111

  Fly   475 RIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWDG--QQPMCRGP 536
            .|:.||:..:...|..||::|..:.|..|.:.|||:|.:|..|     ||:.:.  ...:|.||
Mouse   112 FIEGNKIETISRNAFRGLRDLTHLDLRGNKFECDCKAKWLYLW-----LKMTNSTVSDVLCIGP 170

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7509	NP_647931.1	LRR_8	182..241	CDD:290566
		leucine-rich repeat	187..206	CDD:275380
		LRR_RI	<201..386	CDD:238064
		leucine-rich repeat	207..230	CDD:275380
		leucine-rich repeat	231..254	CDD:275380
		LRR_8	253..313	CDD:290566
		leucine-rich repeat	255..278	CDD:275380
		leucine-rich repeat	279..302	CDD:275380
		LRR_8	303..361	CDD:290566
		leucine-rich repeat	303..326	CDD:275380
		leucine-rich repeat	327..350	CDD:275380
		LRR_8	349..407	CDD:290566
		LRR_4	350..390	CDD:289563
		leucine-rich repeat	351..374	CDD:275380
		leucine-rich repeat	375..398	CDD:275380
		LRR_8	398..>443	CDD:290566	10/32 (31%)
		leucine-rich repeat	399..422	CDD:275380	2/9 (22%)
		leucine-rich repeat	423..443	CDD:275380	7/21 (33%)
		leucine-rich repeat	471..494	CDD:275380	9/22 (41%)
		LRRCT	503..554	CDD:214507	12/36 (33%)
Lgi2	NP_659194.1	leucine-rich repeat	63..83	CDD:275380	8/24 (33%)
		LRR_8	94..142	CDD:290566	15/47 (32%)
		LRR_4	107..143	CDD:289563	12/35 (34%)
		leucine-rich repeat	108..131	CDD:275378	9/22 (41%)
		TPKR_C2	140..>174	CDD:301599	12/36 (33%)
		EPTP	224..265	CDD:281697
		EPTP	271..311	CDD:281697
		EPTP	316..362	CDD:281697
		EPTP	365..407	CDD:281697
		EPTP	412..454	CDD:281697
		EPTP	457..498	CDD:281697
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000