DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7509 and Lgi4

DIOPT Version :9

Sequence 1:	NP_647931.1	Gene:	CG7509 / 38579	FlyBaseID:	FBgn0035575	Length:	615	Species:	Drosophila melanogaster
Sequence 2:	NP_653139.2	Gene:	Lgi4 / 243914	MGIID:	2180197	Length:	537	Species:	Mus musculus

Alignment Length:	138	Identity:	45/138 - (32%)
Similarity:	66/138 - (47%)	Gaps:	3/138 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   399 LNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDAR 463
            |..|.|.:..:|.:.|..||.:.:|..|...||..:.:|.|.|.||:.|:.|.:.:|.:.:....
Mouse    54 LLSLSLVRMGVSRLKAGSFLKMPSLHLLLFTSNTFSVIEGDAFIGLSYLQYLFIEDNKIGSISKN 118

  Fly   464 AFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWDG 528
            |...|..|..|.:.:|.|..||.....||:.|..|.|..||:.||||.|:|.:|:......:..|
Mouse   119 ALRGLRSLTHLSLANNHLEALPRFLFRGLETLTHVDLRGNPFQCDCRVLWLLQWMPTVNASVGTG 183

  Fly   529 QQPMCRGP 536
               .|.||
Mouse   184 ---ACAGP 188

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7509	NP_647931.1	LRR_8	182..241	CDD:290566
		leucine-rich repeat	187..206	CDD:275380
		LRR_RI	<201..386	CDD:238064
		leucine-rich repeat	207..230	CDD:275380
		leucine-rich repeat	231..254	CDD:275380
		LRR_8	253..313	CDD:290566
		leucine-rich repeat	255..278	CDD:275380
		leucine-rich repeat	279..302	CDD:275380
		LRR_8	303..361	CDD:290566
		leucine-rich repeat	303..326	CDD:275380
		leucine-rich repeat	327..350	CDD:275380
		LRR_8	349..407	CDD:290566	3/7 (43%)
		LRR_4	350..390	CDD:289563
		leucine-rich repeat	351..374	CDD:275380
		leucine-rich repeat	375..398	CDD:275380
		LRR_8	398..>443	CDD:290566	14/43 (33%)
		leucine-rich repeat	399..422	CDD:275380	7/22 (32%)
		leucine-rich repeat	423..443	CDD:275380	7/19 (37%)
		leucine-rich repeat	471..494	CDD:275380	8/22 (36%)
		LRRCT	503..554	CDD:214507	13/34 (38%)
Lgi4	NP_653139.2	LRR 1	53..74		6/19 (32%)
		leucine-rich repeat	54..77	CDD:275378	7/22 (32%)
		LRR_8	76..136	CDD:290566	17/59 (29%)
		LRR 2	77..98		7/20 (35%)
		leucine-rich repeat	78..101	CDD:275378	9/22 (41%)
		LRR 3	101..122		4/20 (20%)
		LRR_4	102..140	CDD:289563	9/37 (24%)
		leucine-rich repeat	102..125	CDD:275378	5/22 (23%)
		LRR 4	125..146		6/20 (30%)
		leucine-rich repeat	126..149	CDD:275378	8/22 (36%)
		leucine-rich repeat	150..162	CDD:275378	5/11 (45%)
		LRRCT	158..206	CDD:214507	13/34 (38%)
		EAR 1. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	210..252
		EPTP	<220..251	CDD:281697
		EAR 2. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	256..298
		EAR 3. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	302..349
		EAR 4. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	351..394
		EPTP	351..392	CDD:281697
		EAR 5. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	396..439
		EPTP	396..438	CDD:281697
		EAR 6. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	441..483
		EAR 7. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	487..532
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167831235
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930