DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and Lingo3

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001013780.2 Gene:Lingo3 / 237403 MGIID:3609246 Length:589 Species:Mus musculus


Alignment Length:394 Identity:112/394 - (28%)
Similarity:179/394 - (45%) Gaps:41/394 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 CRCNPDTKSFTCWNTNLKSVPVTQVIPMNMVNIDLSRNILSTLHKDTFRGLTVLKELDISHNVLD 218
            |.|:..|::..|....|.::|  :.||.....::||||.:..|:......|..|:|||::|||:.
Mouse    28 CECSASTRTVACGRRRLTAIP--EGIPAETRMLELSRNRIRCLNPGDLASLPTLEELDLNHNVIA 90

  Fly   219 FLPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIGMLPESIFYHAQRLTVIN 283
            .:....|.:|..|.|||::.|||:.|....|..|.:|.:||||:|::.:|.:..|...:.|..:.
Mouse    91 HVEPGAFANLPRLRVLRLRGNQLKLIPPGVFTHLDSLTLLDLSENKLVILLDFSFQDLRSLQRLE 155

  Fly   284 MCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGL 348
            :.||.:...........|.|.||.:.|..::.||..|:.:|..|..|......||.::|..|..|
Mouse   156 VGDNDLVFISRRAFAGLLGLAELTLERCNLTSLSPESLGHLRGLGALRLRHLAIAALEDQNFQKL 220

  Fly   349 RSLRTLSLHNNRI------SSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQN 407
            ..|..|.:.|..:      .||.|      .||.:|.:|...|:.:...|..:..:|..|.|..|
Mouse   221 PGLSHLEIDNWPLLEEVAPGSLRG------LNLTSLSITHTNITAVPAAALRQQAHLTCLNLSHN 279

  Fly   408 SMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLE 472
            .:|.:|...|.::..|..|.|....|..:|...|.||..:::|.|::|:|...:...|..::.||
Mouse   280 PISMVPRGSFRDLVRLRELHLAGALLAVIEPQAFVGLRQIRLLNLSDNLLSTLEENTFHSVNTLE 344

  Fly   473 KLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQPMCRGPG 537
            .||:|.                        ||..||||.|::.:  |...|. :||:.|.|..|.
Mouse   345 TLRVDG------------------------NPLACDCRLLWIVQ--RRKTLN-FDGRLPACATPA 382

  Fly   538 DLGG 541
            ::.|
Mouse   383 EVRG 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 20/58 (34%)
leucine-rich repeat 187..206 CDD:275380 6/18 (33%)
LRR_RI <201..386 CDD:238064 57/190 (30%)
leucine-rich repeat 207..230 CDD:275380 9/22 (41%)
leucine-rich repeat 231..254 CDD:275380 10/22 (45%)
LRR_8 253..313 CDD:290566 16/59 (27%)
leucine-rich repeat 255..278 CDD:275380 8/22 (36%)
leucine-rich repeat 279..302 CDD:275380 3/22 (14%)
LRR_8 303..361 CDD:290566 18/57 (32%)
leucine-rich repeat 303..326 CDD:275380 8/22 (36%)
leucine-rich repeat 327..350 CDD:275380 7/22 (32%)
LRR_8 349..407 CDD:290566 15/63 (24%)
LRR_4 350..390 CDD:289563 11/45 (24%)
leucine-rich repeat 351..374 CDD:275380 6/28 (21%)
leucine-rich repeat 375..398 CDD:275380 5/22 (23%)
LRR_8 398..>443 CDD:290566 13/44 (30%)
leucine-rich repeat 399..422 CDD:275380 7/22 (32%)
leucine-rich repeat 423..443 CDD:275380 6/19 (32%)
leucine-rich repeat 471..494 CDD:275380 5/22 (23%)
LRRCT 503..554 CDD:214507 15/39 (38%)
Lingo3NP_001013780.2 LRRNT 23..55 CDD:214470 8/28 (29%)
leucine-rich repeat 34..53 CDD:275380 5/20 (25%)
LRR 1 54..75 5/20 (25%)
LRR <55..353 CDD:227223 90/327 (28%)
leucine-rich repeat 55..78 CDD:275380 6/22 (27%)
LRR 2 78..99 8/20 (40%)
leucine-rich repeat 79..102 CDD:275380 9/22 (41%)
LRR 3 102..123 9/20 (45%)
leucine-rich repeat 103..150 CDD:275380 18/46 (39%)
LRR 4 126..147 8/20 (40%)
LRR 5 150..171 3/20 (15%)
leucine-rich repeat 151..174 CDD:275380 3/22 (14%)
LRR 6 174..195 7/20 (35%)
leucine-rich repeat 175..198 CDD:275380 8/22 (36%)
leucine-rich repeat 199..222 CDD:275380 7/22 (32%)
LRR 7 206..227 6/20 (30%)
leucine-rich repeat 223..246 CDD:275380 6/28 (21%)
LRR_8 246..302 CDD:338972 16/55 (29%)
LRR 8 246..267 6/20 (30%)
leucine-rich repeat 247..270 CDD:275380 5/22 (23%)
LRR 9 270..291 7/20 (35%)
leucine-rich repeat 271..292 CDD:275380 7/20 (35%)
LRR 10 294..315 6/20 (30%)
leucine-rich repeat 295..318 CDD:275380 8/22 (36%)
LRR 11 318..339 5/20 (25%)
leucine-rich repeat 321..342 CDD:275380 5/20 (25%)
PCC 331..>405 CDD:188093 21/83 (25%)
I-set 406..496 CDD:369462
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6410
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.