DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and Elfn2

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001345621.1 Gene:Elfn2 / 207393 MGIID:3608416 Length:823 Species:Mus musculus


Alignment Length:287 Identity:69/287 - (24%)
Similarity:121/287 - (42%) Gaps:57/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 SLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPA 414
            ::..|.|:.|::.::..:..|...||..|:||.|.||:|:..||:...:|..|.||.|.:|::..
Mouse    56 TVHDLRLNENKLKAVLYSSLNRFGNLTDLNLTKNEISYIEDGAFLGQTSLQVLQLGYNRLSNLTE 120

  Fly   415 DLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSN 479
            .:                        .:|::.|:.|.:.:|:::.....||.....|..:.:.||
Mouse   121 GM------------------------LRGMSRLQFLFVQHNLIEVVTPTAFSECPSLISIDLSSN 161

  Fly   480 KLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREF--VLKLWDGQQPMCRGPGDLGGH 542
            :|..|.......|.:|:..:|..||::|:|.......|:..|  |.|.:|..|  |..|.:..|:
Mouse   162 RLSRLDGATFASLASLMVCELAGNPFNCECDLFGFLAWLVVFNNVTKNYDRLQ--CESPREFAGY 224

  Fly   543 EVGLLR-YDDLCDGQWASMLSLSPR---LPVRKHQISTPMNY-TDY---------FN----LYLK 589
            .:.:.| |..|   ...::|....|   :|.|  .:|.|..| ||.         ||    |.::
Mouse   225 PLLVPRPYHSL---NAITVLQAKCRNGSMPAR--PVSHPTPYSTDAQREPDENSGFNPDEILSVE 284

  Fly   590 HIYNGTTDE------ELKEADITSVSI 610
            ...:.|||.      :|.:...||.::
Mouse   285 PPASSTTDASAGPAIKLHQVTFTSATL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566
leucine-rich repeat 187..206 CDD:275380
LRR_RI <201..386 CDD:238064 10/35 (29%)
leucine-rich repeat 207..230 CDD:275380
leucine-rich repeat 231..254 CDD:275380
LRR_8 253..313 CDD:290566
leucine-rich repeat 255..278 CDD:275380
leucine-rich repeat 279..302 CDD:275380
LRR_8 303..361 CDD:290566 3/10 (30%)
leucine-rich repeat 303..326 CDD:275380
leucine-rich repeat 327..350 CDD:275380 69/287 (24%)
LRR_8 349..407 CDD:290566 19/56 (34%)
LRR_4 350..390 CDD:289563 13/39 (33%)
leucine-rich repeat 351..374 CDD:275380 4/22 (18%)
leucine-rich repeat 375..398 CDD:275380 10/22 (45%)
LRR_8 398..>443 CDD:290566 6/44 (14%)
leucine-rich repeat 399..422 CDD:275380 6/22 (27%)
leucine-rich repeat 423..443 CDD:275380 0/19 (0%)
leucine-rich repeat 471..494 CDD:275380 6/22 (27%)
LRRCT 503..554 CDD:214507 16/53 (30%)
Elfn2NP_001345621.1 LRR 1 56..77 3/20 (15%)
leucine-rich repeat 60..80 CDD:275378 4/19 (21%)
LRR_8 80..139 CDD:404697 21/82 (26%)
LRR 2 80..101 11/20 (55%)
leucine-rich repeat 81..104 CDD:275378 10/22 (45%)
LRR 3 104..125 6/44 (14%)
leucine-rich repeat 105..128 CDD:275378 7/46 (15%)
LRR_8 127..187 CDD:404697 14/59 (24%)
LRR 4 128..149 5/20 (25%)
leucine-rich repeat 129..152 CDD:275378 5/22 (23%)
LRR 5 152..173 5/20 (25%)
leucine-rich repeat 153..166 CDD:275378 4/12 (33%)
PCC 157..>227 CDD:188093 20/71 (28%)
leucine-rich repeat 177..189 CDD:275378 4/11 (36%)
leucine-rich repeat 200..226 CDD:275380 8/27 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..294 13/46 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 590..624
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.