DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7509 and LGI3

DIOPT Version :9

Sequence 1:	NP_647931.1	Gene:	CG7509 / 38579	FlyBaseID:	FBgn0035575	Length:	615	Species:	Drosophila melanogaster
Sequence 2:	NP_644807.1	Gene:	LGI3 / 203190	HGNCID:	18711	Length:	548	Species:	Homo sapiens

Alignment Length:	166	Identity:	42/166 - (25%)
Similarity:	67/166 - (40%)	Gaps:	48/166 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly   353 TLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLF 417
            :|:|.|...|.:....|::|..|..|.|.:|:.:.|..|||..|::|..||:..|.:.::....|
Human    68 SLTLVNAAFSEIQDGAFSHLPLLQFLLLNSNKFTLIGDNAFTGLSHLQYLFIENNDIWALSKFTF 132

  Fly   418 LNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLM 482
            ..:.:||.|:|.:|||.||..|.|:.|          :||.:.|.|.
Human   133 RGLKSLTHLSLANNNLQTLPRDIFRPL----------DILNDLDLRG------------------ 169

  Fly   483 FLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWI 518
                                |..:|||:..:|..|:
Human   170 --------------------NSLNCDCKVKWLVEWL 185

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7509	NP_647931.1	LRR_8	182..241	CDD:290566
		leucine-rich repeat	187..206	CDD:275380
		LRR_RI	<201..386	CDD:238064	10/32 (31%)
		leucine-rich repeat	207..230	CDD:275380
		leucine-rich repeat	231..254	CDD:275380
		LRR_8	253..313	CDD:290566
		leucine-rich repeat	255..278	CDD:275380
		leucine-rich repeat	279..302	CDD:275380
		LRR_8	303..361	CDD:290566	3/7 (43%)
		leucine-rich repeat	303..326	CDD:275380
		leucine-rich repeat	327..350	CDD:275380
		LRR_8	349..407	CDD:290566	18/53 (34%)
		LRR_4	350..390	CDD:289563	11/36 (31%)
		leucine-rich repeat	351..374	CDD:275380	6/20 (30%)
		leucine-rich repeat	375..398	CDD:275380	9/22 (41%)
		LRR_8	398..>443	CDD:290566	16/44 (36%)
		leucine-rich repeat	399..422	CDD:275380	5/22 (23%)
		leucine-rich repeat	423..443	CDD:275380	11/19 (58%)
		leucine-rich repeat	471..494	CDD:275380	0/22 (0%)
		LRRCT	503..554	CDD:214507	6/16 (38%)
LGI3	NP_644807.1	LRR_8	68..124	CDD:290566	19/55 (35%)
		leucine-rich repeat	68..89	CDD:275378	6/20 (30%)
		LRR 1	89..110		8/20 (40%)
		leucine-rich repeat	90..113	CDD:275378	9/22 (41%)
		LRR_8	112..172	CDD:290566	22/107 (21%)
		LRR_4	113..152	CDD:289563	13/38 (34%)
		LRR 2	113..134		5/20 (25%)
		leucine-rich repeat	114..137	CDD:275378	5/22 (23%)
		LRR	135..158	CDD:197688	11/22 (50%)
		LRR 3	137..158		11/20 (55%)
		leucine-rich repeat	138..161	CDD:275378	12/32 (38%)
		leucine-rich repeat	162..174	CDD:275378	4/49 (8%)
		LRRCT	170..218	CDD:214507	6/16 (38%)
		EAR 1. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	222..264
		EPTP	222..263	CDD:281697
		EAR 2. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	268..310
		EPTP	268..309	CDD:281697
		EAR 3. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	314..361
		EPTP	314..359	CDD:281697
		EAR 4. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	363..406
		EPTP	363..405	CDD:281697
		EAR 5. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	410..453
		EPTP	410..452	CDD:281697
		EAR 6. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	455..497
		EPTP	455..496	CDD:281697
		EAR 7. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	501..543
		EPTP	501..541	CDD:281697
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000