DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and Lrrn3

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001258637.1 Gene:Lrrn3 / 16981 MGIID:106036 Length:707 Species:Mus musculus


Alignment Length:411 Identity:104/411 - (25%)
Similarity:164/411 - (39%) Gaps:70/411 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 RCNPDTKSFTCWNTNLKSVPVTQVIPMNMVNIDLSRNILSTLHKDTFRGLTVLKELDISHNVLDF 219
            |...||:.......|:..:..:...|:|:..:|||:|.||::.....:.::.|..:.:..|.|..
Mouse    66 RLPADTQILLLQTNNIARIEHSTDFPVNLTGLDLSQNNLSSVTNINVQKMSQLLSVYLEENKLTE 130

  Fly   220 LPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIGMLPESIFYHAQRLTVINM 284
            ||......|.:|..|.:.:|.|..|....|..|.||..|.|:.|.:.|:....|.....|.::.:
Mouse   131 LPEKCLYGLSNLQELYVNHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSQWFDALPNLEILML 195

  Fly   285 CDNQI-----QNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDF 344
            .||.|     .||.|                             |.||::|......:.:|.||.
Mouse   196 GDNPIIRIKDMNFQP-----------------------------LVKLRSLVIAGINLTEIPDDA 231

  Fly   345 FAGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSM 409
            .|||.:|.::|.::||:|.:.........||..|||..|.|:.|....|..:.:|.||.:     
Mouse   232 LAGLENLESISFYDNRLSKVPQVALQKAVNLKFLDLNKNPINRIRRGDFSNMLHLKELGI----- 291

  Fly   410 SSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNL----KILLLNNNILKNFDARAFEPLSQ 470
                                 ||:..|.:.|...::||    ||...||..|......||..|.:
Mouse   292 ---------------------NNMPELVSIDSLAVDNLPDLRKIEATNNPRLSYIHPNAFFRLPK 335

  Fly   471 LEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWI--REFVLKLWDGQQPMC 533
            ||.|.:::|.|..|.||.:..|.||..:.:..||..|||    :.|||  .:..::..:.....|
Mouse   336 LESLMLNTNALSALYHGTIESLPNLKEISIHSNPIRCDC----VIRWINMNKTNIRFMEPDSLFC 396

  Fly   534 RGPGDLGGHEVGLLRYDDLCD 554
            ..|.:..|..|..:.:.|:.:
Mouse   397 VDPPEFQGQNVRQVHFRDMME 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 16/58 (28%)
leucine-rich repeat 187..206 CDD:275380 6/18 (33%)
LRR_RI <201..386 CDD:238064 48/189 (25%)
leucine-rich repeat 207..230 CDD:275380 6/22 (27%)
leucine-rich repeat 231..254 CDD:275380 7/22 (32%)
LRR_8 253..313 CDD:290566 14/64 (22%)
leucine-rich repeat 255..278 CDD:275380 6/22 (27%)
leucine-rich repeat 279..302 CDD:275380 7/27 (26%)
LRR_8 303..361 CDD:290566 13/57 (23%)
leucine-rich repeat 303..326 CDD:275380 1/22 (5%)
leucine-rich repeat 327..350 CDD:275380 8/22 (36%)
LRR_8 349..407 CDD:290566 17/57 (30%)
LRR_4 350..390 CDD:289563 13/39 (33%)
leucine-rich repeat 351..374 CDD:275380 5/22 (23%)
leucine-rich repeat 375..398 CDD:275380 8/22 (36%)
LRR_8 398..>443 CDD:290566 7/44 (16%)
leucine-rich repeat 399..422 CDD:275380 3/22 (14%)
leucine-rich repeat 423..443 CDD:275380 4/19 (21%)
leucine-rich repeat 471..494 CDD:275380 9/22 (41%)
LRRCT 503..554 CDD:214507 13/52 (25%)
Lrrn3NP_001258637.1 LRRNT 28..72 CDD:214470 2/5 (40%)
LRR 1 70..91 3/20 (15%)
leucine-rich repeat 72..93 CDD:275380 2/20 (10%)
LRR_8 93..152 CDD:290566 16/58 (28%)
LRR 2 93..114 7/20 (35%)
leucine-rich repeat 94..117 CDD:275380 6/22 (27%)
LRR 3 117..138 5/20 (25%)
leucine-rich repeat 118..141 CDD:275380 6/22 (27%)
LRR 139..160 CDD:197688 6/20 (30%)
LRR 4 141..162 6/20 (30%)
leucine-rich repeat 142..165 CDD:275380 7/22 (32%)
LRR 5 165..186 7/20 (35%)
leucine-rich repeat 166..189 CDD:275380 6/22 (27%)
LRR_8 173..221 CDD:290566 14/76 (18%)
LRR 6 189..210 6/20 (30%)
leucine-rich repeat 190..213 CDD:275380 8/51 (16%)
LRR_8 213..272 CDD:290566 20/58 (34%)
LRR 7 213..234 6/20 (30%)
leucine-rich repeat 214..237 CDD:275380 8/22 (36%)
LRR 8 237..258 5/20 (25%)
leucine-rich repeat 238..261 CDD:275380 5/22 (23%)
LRR 9 261..282 9/20 (45%)
leucine-rich repeat 262..285 CDD:275380 8/22 (36%)
LRR 10 285..304 7/44 (16%)
leucine-rich repeat 286..310 CDD:275380 9/49 (18%)
LRR 11 310..332 7/21 (33%)
LRR_8 311..370 CDD:290566 20/58 (34%)
leucine-rich repeat 311..333 CDD:275380 7/21 (33%)
LRR 12 335..358 8/22 (36%)
leucine-rich repeat 336..359 CDD:275380 9/22 (41%)
LRRCT 368..419 CDD:214507 13/54 (24%)
I-set 429..513 CDD:254352
Ig 440..513 CDD:299845
fn3 526..593 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.