DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and ADGRA3

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_660333.2 Gene:ADGRA3 / 166647 HGNCID:13839 Length:1321 Species:Homo sapiens


Alignment Length:180 Identity:54/180 - (30%)
Similarity:82/180 - (45%) Gaps:28/180 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 VTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADD 440
            |||.|:.|:||.:...:|..|:.|..|.|..|.:|||....|..:|:|.||.|.:|.:..|.||.
Human    84 VTLILSNNKISELKNGSFSGLSLLERLDLRNNLISSIDPGAFWGLSSLKRLDLTNNRIGCLNADI 148

  Fly   441 FQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPW 505
            |:||.||..|.|:.|:..:.....|:.|:.|..|...:..|:                       
Human   149 FRGLTNLVRLNLSGNLFSSLSQGTFDYLASLRSL
EFQTEYLL----------------------- 190

  Fly   506 HCDCRALYLARWIREFVLKLWDGQQPMCRGPGDLGGHEVGLLRYDDL-CD 554
             |||..|::.||::|..:.:.|.:   |..|..|....|..::.:.| ||
Human   191 -CDCNILWMHRWVKEKNITVRDTR---CVYPKSLQAQPVTGVKQELLTCD 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566
leucine-rich repeat 187..206 CDD:275380
LRR_RI <201..386 CDD:238064 5/9 (56%)
leucine-rich repeat 207..230 CDD:275380
leucine-rich repeat 231..254 CDD:275380
LRR_8 253..313 CDD:290566
leucine-rich repeat 255..278 CDD:275380
leucine-rich repeat 279..302 CDD:275380
LRR_8 303..361 CDD:290566
leucine-rich repeat 303..326 CDD:275380
leucine-rich repeat 327..350 CDD:275380
LRR_8 349..407 CDD:290566 12/30 (40%)
LRR_4 350..390 CDD:289563 7/13 (54%)
leucine-rich repeat 351..374 CDD:275380
leucine-rich repeat 375..398 CDD:275380 9/21 (43%)
LRR_8 398..>443 CDD:290566 18/44 (41%)
leucine-rich repeat 399..422 CDD:275380 8/22 (36%)
leucine-rich repeat 423..443 CDD:275380 9/19 (47%)
leucine-rich repeat 471..494 CDD:275380 3/22 (14%)
LRRCT 503..554 CDD:214507 13/51 (25%)
ADGRA3NP_660333.2 LRR_RI <70..>182 CDD:238064 37/97 (38%)
LRR 1 82..103 8/18 (44%)
leucine-rich repeat 83..106 CDD:275378 9/21 (43%)
LRR_8 85..141 CDD:290566 22/55 (40%)
LRR 2 106..127 8/20 (40%)
LRR_4 107..146 CDD:289563 15/38 (39%)
leucine-rich repeat 107..130 CDD:275378 8/22 (36%)
LRR_8 129..182 CDD:290566 20/52 (38%)
LRR 3 130..151 9/20 (45%)
leucine-rich repeat 131..154 CDD:275378 11/22 (50%)
LRR 4 154..175 6/20 (30%)
leucine-rich repeat 155..178 CDD:275378 6/22 (27%)
LRRCT 189..>223 CDD:214507 12/60 (20%)
IG_like 249..341 CDD:214653
Ig 262..337 CDD:143165
HRM <363..416 CDD:280888
LRR 5 594..620
GPS 704..743 CDD:280071
7tm_4 796..>945 CDD:304433
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1073..1094
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1198..1219
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1231..1265
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1294..1321
PDZ-binding. /evidence=ECO:0000255 1319..1321
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.