DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and CHADL

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_011528235.1 Gene:CHADL / 150356 HGNCID:25165 Length:830 Species:Homo sapiens


Alignment Length:376 Identity:103/376 - (27%)
Similarity:147/376 - (39%) Gaps:64/376 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 GLTVLKELDISHNVLDFLPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIGM 267
            |||  :.||:..|:|..:|...||                .:.|.|.        |||...|:.:
Human   130 GLT--QRLDLQGNLLKVIPAAAFQ----------------GVPHLTH--------LDLRHCEVEL 168

  Fly   268 LPESIFYHAQRLTVINMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDF 332
            :.|..|....||.::|:..|.::..|...|.....|..|::..|.:.||..|:            
Human   169 VAEGAFRGLGRLLLLNLASNHLRELPQEALDGLGSLRRLELEGNALEELRPGT------------ 221

  Fly   333 GWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELN 397
                        |..|.:|.||:|.:|.:..|....|..|..:..|.|:.|.:|.:...|...|.
Human   222 ------------FGALGALATLNLAHNALVYLPAMAFQGLLRVRWLRLSHNALSVLAPEALAGLP 274

  Fly   398 NLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDA 462
            .|..|.|..|.:.::|..:......|.||.|..|.||....:|...|..|:.|||:...|:....
Human   275 ALRRLSLHHNELQALPGPVLSQARGLARLELGHNPLTYAGEEDGLALPGLRELLLDGGALQALGP 339

  Fly   463 RAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWD 527
            |||....:|..|.:..|:|..||  .|.|...|..::|..||..|.|:|..|..|:....::. |
Human   340 RAFAHCPRLHTLDLRGNQLDTLP--PLQGPGQLRRLRLQGNPLWCGCQARPLLEWLARARVRS-D 401

  Fly   528 GQQPMCRGPGDLGGHEVGLLRYDDL-CDGQWA-------SMLSLSPRLPVR 570
            |   .|:||..|.|..:..||..|| |.|..|       ......||.|.|
Human   402 G---ACQGPRRLRGEALDALRPWDLRCPGDAAQEEEELEERAVAGPRAPPR 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 10/37 (27%)
leucine-rich repeat 187..206 CDD:275380 2/2 (100%)
LRR_RI <201..386 CDD:238064 43/182 (24%)
leucine-rich repeat 207..230 CDD:275380 7/22 (32%)
leucine-rich repeat 231..254 CDD:275380 2/22 (9%)
LRR_8 253..313 CDD:290566 15/59 (25%)
leucine-rich repeat 255..278 CDD:275380 6/22 (27%)
leucine-rich repeat 279..302 CDD:275380 5/22 (23%)
LRR_8 303..361 CDD:290566 13/57 (23%)
leucine-rich repeat 303..326 CDD:275380 6/22 (27%)
leucine-rich repeat 327..350 CDD:275380 2/22 (9%)
LRR_8 349..407 CDD:290566 17/57 (30%)
LRR_4 350..390 CDD:289563 12/39 (31%)
leucine-rich repeat 351..374 CDD:275380 8/22 (36%)
leucine-rich repeat 375..398 CDD:275380 6/22 (27%)
LRR_8 398..>443 CDD:290566 13/44 (30%)
leucine-rich repeat 399..422 CDD:275380 5/22 (23%)
leucine-rich repeat 423..443 CDD:275380 8/19 (42%)
leucine-rich repeat 471..494 CDD:275380 8/22 (36%)
LRRCT 503..554 CDD:214507 18/51 (35%)
CHADLXP_011528235.1 leucine-rich repeat 132..155 CDD:275380 8/40 (20%)
LRR_RI <133..358 CDD:238064 68/272 (25%)
LRR_8 133..214 CDD:290566 24/104 (23%)
leucine-rich repeat 156..179 CDD:275380 7/30 (23%)
leucine-rich repeat 180..203 CDD:275380 5/22 (23%)
leucine-rich repeat 204..227 CDD:275380 8/46 (17%)
LRR_8 228..286 CDD:290566 18/57 (32%)
leucine-rich repeat 228..251 CDD:275380 8/22 (36%)
leucine-rich repeat 252..275 CDD:275380 6/22 (27%)
leucine-rich repeat 276..299 CDD:275380 5/22 (23%)
leucine-rich repeat 300..323 CDD:275380 9/22 (41%)
LRR_8 322..380 CDD:290566 19/59 (32%)
leucine-rich repeat 324..347 CDD:275380 8/22 (36%)
LRR_4 346..>380 CDD:289563 11/35 (31%)
LRRNT 463..497 CDD:214470
leucine-rich repeat 478..494 CDD:275380
LRR_RI 492..671 CDD:238064
leucine-rich repeat 495..518 CDD:275380
LRR_8 518..577 CDD:290566
leucine-rich repeat 519..542 CDD:275380
leucine-rich repeat 543..566 CDD:275380
LRR_8 565..625 CDD:290566
leucine-rich repeat 567..590 CDD:275380
leucine-rich repeat 591..614 CDD:275380
leucine-rich repeat 615..638 CDD:275380
LRR_8 637..698 CDD:290566
leucine-rich repeat 639..662 CDD:275380
leucine-rich repeat 663..687 CDD:275380
LRR_8 686..745 CDD:290566
leucine-rich repeat 688..712 CDD:275380
LRR_4 711..>744 CDD:289563
LRRCT 743..791 CDD:214507
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141292
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.