| Sequence 1: | NP_647931.1 | Gene: | CG7509 / 38579 | FlyBaseID: | FBgn0035575 | Length: | 615 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001333102.1 | Gene: | LRFN5 / 145581 | HGNCID: | 20360 | Length: | 719 | Species: | Homo sapiens |
| Alignment Length: | 301 | Identity: | 84/301 - (27%) |
|---|---|---|---|
| Similarity: | 129/301 - (42%) | Gaps: | 73/301 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 293 PPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLH 357
Fly 358 NNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFLNVSA 422
Fly 423 LTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFLPHG 487
Fly 488 ALHGLKNLV-----------AVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQPMCRGPGDLGG 541
Fly 542 ----------------------HEVGLLRYDDLCDGQWASM 560 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7509 | NP_647931.1 | LRR_8 | 182..241 | CDD:290566 | |
| leucine-rich repeat | 187..206 | CDD:275380 | |||
| LRR_RI | <201..386 | CDD:238064 | 27/92 (29%) | ||
| leucine-rich repeat | 207..230 | CDD:275380 | |||
| leucine-rich repeat | 231..254 | CDD:275380 | |||
| LRR_8 | 253..313 | CDD:290566 | 7/19 (37%) | ||
| leucine-rich repeat | 255..278 | CDD:275380 | |||
| leucine-rich repeat | 279..302 | CDD:275380 | 4/8 (50%) | ||
| LRR_8 | 303..361 | CDD:290566 | 13/57 (23%) | ||
| leucine-rich repeat | 303..326 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 327..350 | CDD:275380 | 4/22 (18%) | ||
| LRR_8 | 349..407 | CDD:290566 | 22/57 (39%) | ||
| LRR_4 | 350..390 | CDD:289563 | 16/39 (41%) | ||
| leucine-rich repeat | 351..374 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 375..398 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 398..>443 | CDD:290566 | 17/44 (39%) | ||
| leucine-rich repeat | 399..422 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 423..443 | CDD:275380 | 8/19 (42%) | ||
| leucine-rich repeat | 471..494 | CDD:275380 | 8/22 (36%) | ||
| LRRCT | 503..554 | CDD:214507 | 18/72 (25%) | ||
| LRFN5 | NP_001333102.1 | LRR 1 | 52..73 | 7/47 (15%) | |
| LRR 2 | 76..97 | 8/20 (40%) | |||
| LRR 3 | 100..121 | 8/20 (40%) | |||
| LRR 4 | 124..145 | 7/20 (35%) | |||
| LRR 5 | 148..169 | 9/20 (45%) | |||
| LRR 6 | 172..193 | 6/20 (30%) | |||
| LRR 7 | 196..217 | 8/20 (40%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 385..414 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 615..694 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||