DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and LRFN5

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001333102.1 Gene:LRFN5 / 145581 HGNCID:20360 Length:719 Species:Homo sapiens


Alignment Length:301 Identity:84/301 - (27%)
Similarity:129/301 - (42%) Gaps:73/301 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 PPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLH 357
            |||:.|..:   ||.::.|           ::|.:|..|             ||.:.||..|:|.
Human    46 PPNIDRRTV---ELRLADN-----------FVTNIKRKD-------------FANMTSLVDLTLS 83

  Fly   358 NNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFLNVSA 422
            .|.||.::...|.:|.||..|.|.:||::.|..:.|..|:||:.|.|..|.::.|.:..|.:|.|
Human    84 RNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFSGLSNLHHLILNNNQLTLISSTAFDDVFA 148

  Fly   423 LTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFLPHG 487
            |..|.|..|||.|:..|..:.:.:|..|.|::|::.|.....|..|.::.:|.:.||||..||..
Human   149 LEELDLSYNNLETIPWDAVEKMVSLHTLSLDHNMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPD 213

  Fly   488 ALHGLKNLV-----------AVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQPMCRGPGDLGG 541
            .|.....::           |:....||.||:|..|:|.|..||..|:       .|..|..|.|
Human   214 PLFQRAQVLATSGIISPSTFALSFGGNPLHCNCELLWLRRLSREDDLE-------TCASPPLLTG 271

  Fly   542 ----------------------HEVGLLRYDDLCDGQWASM 560
                                  ||:.:|      :||.|::
Human   272 RYFWSIPEEEFLCEPPLITRHTHEMRVL------EGQRATL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566
leucine-rich repeat 187..206 CDD:275380
LRR_RI <201..386 CDD:238064 27/92 (29%)
leucine-rich repeat 207..230 CDD:275380
leucine-rich repeat 231..254 CDD:275380
LRR_8 253..313 CDD:290566 7/19 (37%)
leucine-rich repeat 255..278 CDD:275380
leucine-rich repeat 279..302 CDD:275380 4/8 (50%)
LRR_8 303..361 CDD:290566 13/57 (23%)
leucine-rich repeat 303..326 CDD:275380 3/22 (14%)
leucine-rich repeat 327..350 CDD:275380 4/22 (18%)
LRR_8 349..407 CDD:290566 22/57 (39%)
LRR_4 350..390 CDD:289563 16/39 (41%)
leucine-rich repeat 351..374 CDD:275380 8/22 (36%)
leucine-rich repeat 375..398 CDD:275380 8/22 (36%)
LRR_8 398..>443 CDD:290566 17/44 (39%)
leucine-rich repeat 399..422 CDD:275380 7/22 (32%)
leucine-rich repeat 423..443 CDD:275380 8/19 (42%)
leucine-rich repeat 471..494 CDD:275380 8/22 (36%)
LRRCT 503..554 CDD:214507 18/72 (25%)
LRFN5NP_001333102.1 LRR 1 52..73 7/47 (15%)
LRR 2 76..97 8/20 (40%)
LRR 3 100..121 8/20 (40%)
LRR 4 124..145 7/20 (35%)
LRR 5 148..169 9/20 (45%)
LRR 6 172..193 6/20 (30%)
LRR 7 196..217 8/20 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..414
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 615..694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.