DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and AgaP_AGAP007846

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_317652.4 Gene:AgaP_AGAP007846 / 1278113 VectorBaseID:AGAP007846 Length:961 Species:Anopheles gambiae


Alignment Length:368 Identity:97/368 - (26%)
Similarity:154/368 - (41%) Gaps:67/368 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 KELDISHNVLDFLPFDLFQDLDS------LLVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIG 266
            :||.:..:.:|| |. |.:.||.      |.:|.:.|:.:|.::...|..|: |:.:.||..::.
Mosquito    52 QELSVQCDQVDF-PV-LVEALDKYARATPLDLLYVNNSTIEQLEGGLFVNLK-LHNVQLSSCKMR 113

  Fly   267 MLPESIFYHAQRLTVINMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLD 331
            .:.:..|.                       ..:.:|:.|::..|.:.|:...:::.||.|..||
Mosquito   114 RIDDKAFQ-----------------------GQEAVLKNLNLQDNLLEEVPIRALKPLTILNLLD 155

  Fly   332 FGWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLSGTIFNNL-ANLVTLDLTTNRISHIDGNAFVE 395
            ...|::..:.:|.|||||.|.||.|.:|.: :|:...|..| |:|..|:|...:...:. .|...
Mosquito   156 LSKNRLHSVPNDAFAGLRKLSTLKLSDNNV-TLAPFAFRGLEASLKNLNLKGTKQKRVP-EAVRG 218

  Fly   396 LNNLNELFLGQNSMSSIPADL----FLNVSALTRLTLFSNNLTTLEADDFQGL-NNLKILLLNNN 455
            |..|..|.|.||.:..:|...    |..:.|||.|.|..|.:.:|....|.|: ..|..|.|.||
Mosquito   219 LRTLAFLDLSQNGIRELPGGAGVKSFDGLDALTALNLERNLIQSLGETAFSGVRKTLSSLSLLNN 283

  Fly   456 ILKNFDARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNP---------------- 504
            :|..|...|...|.:|..|.|..|.|..||..|..|...:..:.||.||                
Mosquito   284 LLAEFPVGAIHSLRELRVLDIGFNLLTALPETAFRGNPAVTLLALDGNPLPTVPEKALAHLNRTL 348

  Fly   505 ---------WHCDCRALYLARWIREFVLKLWDGQQ--PMCRGP 536
                     .||||:..::|.|||...|::...::  ..|..|
Mosquito   349 RGLSLGGRFLHCDCKLRWVAEWIRNGDLQVTSRERNPQFCGSP 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 11/38 (29%)
leucine-rich repeat 187..206 CDD:275380
LRR_RI <201..386 CDD:238064 46/184 (25%)
leucine-rich repeat 207..230 CDD:275380 7/21 (33%)
leucine-rich repeat 231..254 CDD:275380 6/22 (27%)
LRR_8 253..313 CDD:290566 7/59 (12%)
leucine-rich repeat 255..278 CDD:275380 4/22 (18%)
leucine-rich repeat 279..302 CDD:275380 0/22 (0%)
LRR_8 303..361 CDD:290566 21/57 (37%)
leucine-rich repeat 303..326 CDD:275380 5/22 (23%)
leucine-rich repeat 327..350 CDD:275380 9/22 (41%)
LRR_8 349..407 CDD:290566 18/58 (31%)
LRR_4 350..390 CDD:289563 12/40 (30%)
leucine-rich repeat 351..374 CDD:275380 8/23 (35%)
leucine-rich repeat 375..398 CDD:275380 5/22 (23%)
LRR_8 398..>443 CDD:290566 15/48 (31%)
leucine-rich repeat 399..422 CDD:275380 7/26 (27%)
leucine-rich repeat 423..443 CDD:275380 7/19 (37%)
leucine-rich repeat 471..494 CDD:275380 9/22 (41%)
LRRCT 503..554 CDD:214507 13/61 (21%)
AgaP_AGAP007846XP_317652.4 LRR_RI 67..312 CDD:238064 72/270 (27%)
leucine-rich repeat 79..94 CDD:275380 4/14 (29%)
leucine-rich repeat 102..125 CDD:275380 4/45 (9%)
LRR_8 127..185 CDD:290566 21/57 (37%)
leucine-rich repeat 127..150 CDD:275380 5/22 (23%)
leucine-rich repeat 151..174 CDD:275380 9/22 (41%)
LRR_8 173..260 CDD:290566 28/88 (32%)
leucine-rich repeat 175..198 CDD:275380 8/23 (35%)
leucine-rich repeat 199..221 CDD:275380 5/22 (23%)
leucine-rich repeat 222..249 CDD:275380 7/26 (27%)
LRR_8 250..333 CDD:290566 29/82 (35%)
leucine-rich repeat 250..273 CDD:275380 8/22 (36%)
leucine-rich repeat 299..322 CDD:275380 9/22 (41%)
leucine-rich repeat 323..344 CDD:275380 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.