DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and AgaP_AGAP005496

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_315493.3 Gene:AgaP_AGAP005496 / 1276179 VectorBaseID:AGAP005496 Length:485 Species:Anopheles gambiae


Alignment Length:350 Identity:80/350 - (22%)
Similarity:140/350 - (40%) Gaps:79/350 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 LEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTL--------SLH-- 357
            :|..:.:.|...|..:|:...:|::|..|   :.:..:....:...|.|:.|        |:|  
Mosquito    44 IESSEQAANVQLEPPAGAAADVTRVKFRD---SSMVALPSSLYGAFRQLQELRVWWMHLHSIHID 105

  Fly   358 ---------NNRISSLS---GTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMS 410
                     .|||||::   ||:    ..|..|:|..||:.:||..:..|  ||..|.|..|.:.
Mosquito   106 PRLLSLDAEKNRISSITTEPGTV----PLLRKLELNQNRLRNIDNISVFE--NLEVLELAHNDLR 164

  Fly   411 SIPADLFLNVSALTRLTLFSNNLTTLEAD-DFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKL 474
            ::...:|..:..|..|.|.||||..:.:. ..:.|.:|.:|.||:|.|...|.........|||:
Mosquito   165 TLDLCVFQRMPKLRLLDLSSNNLALVRSSIGAEKLASLTVLYLNDNRLTYLDLSILRSFPALEKV 229

  Fly   475 RIDSNKLMFLPHGALHG-LKNLVAVKLDKNPWHCDCRALYLAR----WIREF-VLKLWDGQQPMC 533
            .:.:|.|:::.|.:|.. |..|....|..|.|||:..|..:.:    .:::| ....:..::.|.
Mosquito   230 HLANNALVYVDHDSLPTMLPRLRVFHLQTNDWHCEGLAELIGQLRKTGVQDFKTFSAFSCKERMV 294

  Fly   534 RG----------------------PGDLGGHEVGLLRYDDLCDGQWASMLSLSPRLPVRKHQIST 576
            .|                      ..:|.||...|:|                 .|...:|:::.
Mosquito   295 EGICCTENKPFALVRKSNQYLASYTSELNGHTRHLMR-----------------ELQHTRHEVAR 342

  Fly   577 PMNYTDYFNLYLKHIYNGTTDEELK 601
            .:...:|..:.|::|  |...|||:
Mosquito   343 LIANDNYTQVSLQNI--GDEVEELR 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566
leucine-rich repeat 187..206 CDD:275380
LRR_RI <201..386 CDD:238064 24/104 (23%)
leucine-rich repeat 207..230 CDD:275380
leucine-rich repeat 231..254 CDD:275380
LRR_8 253..313 CDD:290566 2/9 (22%)
leucine-rich repeat 255..278 CDD:275380
leucine-rich repeat 279..302 CDD:275380
LRR_8 303..361 CDD:290566 13/76 (17%)
leucine-rich repeat 303..326 CDD:275380 4/22 (18%)
leucine-rich repeat 327..350 CDD:275380 2/22 (9%)
LRR_8 349..407 CDD:290566 24/79 (30%)
LRR_4 350..390 CDD:289563 17/61 (28%)
leucine-rich repeat 351..374 CDD:275380 11/44 (25%)
leucine-rich repeat 375..398 CDD:275380 8/22 (36%)
LRR_8 398..>443 CDD:290566 13/45 (29%)
leucine-rich repeat 399..422 CDD:275380 5/22 (23%)
leucine-rich repeat 423..443 CDD:275380 7/20 (35%)
leucine-rich repeat 471..494 CDD:275380 8/23 (35%)
LRRCT 503..554 CDD:214507 13/77 (17%)
AgaP_AGAP005496XP_315493.3 leucine-rich repeat 108..123 CDD:275380 5/14 (36%)
LRR_RI <129..275 CDD:238064 44/147 (30%)
LRR_8 129..187 CDD:290566 19/59 (32%)
LRR_4 131..167 CDD:289563 13/37 (35%)
leucine-rich repeat 131..152 CDD:275380 8/22 (36%)
leucine-rich repeat 153..176 CDD:275380 5/22 (23%)
LRR_8 175..236 CDD:290566 19/60 (32%)
leucine-rich repeat 177..201 CDD:275380 8/23 (35%)
LRR_4 201..>236 CDD:289563 11/34 (32%)
leucine-rich repeat 202..225 CDD:275380 7/22 (32%)
leucine-rich repeat 226..250 CDD:275380 8/23 (35%)
Kinesin_assoc 329..>443 CDD:292801 11/55 (20%)
MreC 401..>468 CDD:302802
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.