DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and GPRTAK1

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_312088.4 Gene:GPRTAK1 / 1273136 VectorBaseID:AGAP002824 Length:491 Species:Anopheles gambiae


Alignment Length:94 Identity:24/94 - (25%)
Similarity:32/94 - (34%) Gaps:40/94 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PPIQSLDEFRQRYLLPLISSDTRNCSLNACESLGIVSQLLMLINSMPNGTQSAAN---DKKPPKS 91
            ||  |.:|:|.|..||..:            .||:            |..:||||   ||:|...
Mosquito   423 PP--STEEYRMRTGLPRPA------------HLGV------------NVLESAANGGSDKQPVVD 461

  Fly    92 KAN---------GHNDGDVNGGEINAMSH 111
            .|.         .||..::.....|  ||
Mosquito   462 IAELQTINFLHLNHNSNELQHSSSN--SH 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566
leucine-rich repeat 187..206 CDD:275380
LRR_RI <201..386 CDD:238064
leucine-rich repeat 207..230 CDD:275380
leucine-rich repeat 231..254 CDD:275380
LRR_8 253..313 CDD:290566
leucine-rich repeat 255..278 CDD:275380
leucine-rich repeat 279..302 CDD:275380
LRR_8 303..361 CDD:290566
leucine-rich repeat 303..326 CDD:275380
leucine-rich repeat 327..350 CDD:275380
LRR_8 349..407 CDD:290566
LRR_4 350..390 CDD:289563
leucine-rich repeat 351..374 CDD:275380
leucine-rich repeat 375..398 CDD:275380
LRR_8 398..>443 CDD:290566
leucine-rich repeat 399..422 CDD:275380
leucine-rich repeat 423..443 CDD:275380
leucine-rich repeat 471..494 CDD:275380
LRRCT 503..554 CDD:214507
GPRTAK1XP_312088.4 7tm_4 86..361 CDD:304433
7tm_1 96..361 CDD:278431
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.