DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and AgaP_AGAP000360

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_310751.5 Gene:AgaP_AGAP000360 / 1271896 VectorBaseID:AGAP000360 Length:1451 Species:Anopheles gambiae


Alignment Length:432 Identity:117/432 - (27%)
Similarity:185/432 - (42%) Gaps:81/432 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 SGVCRCN--PDTKSFTCWNTNLKSVPVT-QVI--PMNMVNI-DLSRNILSTLHKDTFRGLTV--- 206
            :..|.|.  .|.....|....|.::..| |||  |:..::: |..|:: .||..|.|:|...   
Mosquito    81 NSACPCYKFEDGIFLECPGITLAALRSTLQVISSPIQSLSVYDFDRSV-KTLTVDLFQGAAFSTA 144

  Fly   207 --------------------LKELDISHNVLDFL-PFDLFQDLDSLLVLRIQNNQLEDIDHRTFW 250
                                ::.|..||:.|..| |..|......|..|.|.|.:|..:..:...
Mosquito   145 GGSGGGVGLGLDSAAAGNVSIRHLQFSHSSLQQLKPNSLLPLRSHLESLSIINGKLTQVPSKAIV 209

  Fly   251 KLRNLNILDLSKNEIGMLPESIFYHAQRLTVINMCDNQIQNFPPNLLRD-QLMLEELDMSRNKIS 314
            .|:.|.:|||..||||.| |...:|...|..:|:..|||:..|.|.|.. :..|.|||:|.|::.
Mosquito   210 GLKKLMVLDLDANEIGTL-EDYAFHGLHLVKLNLKSNQIERVPTNALAGLEESLAELDLSENRLR 273

  Fly   315 ELSSGSIRYLTKLKTLDFGWNQIAKI--DD-----------------------DFFAGLRSLRTL 354
            :..:.::|.|..|:.:....|:||.:  ||                       |.|....:|:||
Mosquito   274 QFPTLALRQLEHLRLVRLSMNEIASLEPDDSYTRFGALSFLDLSLNNFAELYGDIFGAFPALKTL 338

  Fly   355 SLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAF--------VELNN------------- 398
            ||:||.|..:....|.:|..|.:|||:.|||.::|.:.|        |:|:.             
Mosquito   339 SLYNNFIEQVHRDAFVSLHELQSLDLSHNRIVYLDPDVFAANRRLHTVDLSRNHVHYVSGVFANL 403

  Fly   399 --LNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFD 461
              |.|:||.:|::..:..|.|.|.:.:..|.:..|.|..|:.:....|.:|:.|.|::|:|:...
Mosquito   404 PVLREVFLSENNLLELTDDCFANSTGVKVLYMEHNALQRLDGEALASLASLEQLFLSHNLLEKIP 468

  Fly   462 ARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKN 503
            .|.|||..:|..|.:|.|.|:.|..........|..::|:.|
Mosquito   469 VRFFEPTPELTSLALDGNALLELDERLFQRQGKLRELRLNGN 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 18/83 (22%)
leucine-rich repeat 187..206 CDD:275380 7/18 (39%)
LRR_RI <201..386 CDD:238064 66/234 (28%)
leucine-rich repeat 207..230 CDD:275380 7/23 (30%)
leucine-rich repeat 231..254 CDD:275380 6/22 (27%)
LRR_8 253..313 CDD:290566 25/60 (42%)
leucine-rich repeat 255..278 CDD:275380 11/22 (50%)
leucine-rich repeat 279..302 CDD:275380 8/23 (35%)
LRR_8 303..361 CDD:290566 23/82 (28%)
leucine-rich repeat 303..326 CDD:275380 8/22 (36%)
leucine-rich repeat 327..350 CDD:275380 8/47 (17%)
LRR_8 349..407 CDD:290566 25/80 (31%)
LRR_4 350..390 CDD:289563 17/39 (44%)
leucine-rich repeat 351..374 CDD:275380 10/22 (45%)
leucine-rich repeat 375..398 CDD:275380 11/30 (37%)
LRR_8 398..>443 CDD:290566 12/59 (20%)
leucine-rich repeat 399..422 CDD:275380 8/22 (36%)
leucine-rich repeat 423..443 CDD:275380 4/19 (21%)
leucine-rich repeat 471..494 CDD:275380 6/22 (27%)
LRRCT 503..554 CDD:214507 1/1 (100%)
AgaP_AGAP000360XP_310751.5 leucine-rich repeat 166..188 CDD:275380 7/21 (33%)
LRR_8 188..247 CDD:290566 20/59 (34%)
leucine-rich repeat 190..213 CDD:275380 6/22 (27%)
leucine-rich repeat 214..236 CDD:275380 11/22 (50%)
LRR_8 236..296 CDD:290566 18/59 (31%)
leucine-rich repeat 237..261 CDD:275380 8/23 (35%)
leucine-rich repeat 262..285 CDD:275380 8/22 (36%)
LRR_RI 267..512 CDD:238064 64/244 (26%)
leucine-rich repeat 286..310 CDD:275380 6/23 (26%)
leucine-rich repeat 311..334 CDD:275380 2/22 (9%)
LRR_8 314..369 CDD:290566 17/54 (31%)
leucine-rich repeat 335..358 CDD:275380 10/22 (45%)
LRR_8 358..416 CDD:290566 16/57 (28%)
leucine-rich repeat 359..382 CDD:275380 9/22 (41%)
leucine-rich repeat 383..405 CDD:275380 2/21 (10%)
LRR_8 404..464 CDD:290566 17/59 (29%)
leucine-rich repeat 406..429 CDD:275380 8/22 (36%)
leucine-rich repeat 430..453 CDD:275380 5/22 (23%)
LRR_8 453..512 CDD:290566 18/58 (31%)
leucine-rich repeat 454..477 CDD:275380 9/22 (41%)
leucine-rich repeat 478..501 CDD:275380 6/22 (27%)
LRR_8 501..560 CDD:290566 3/10 (30%)
leucine-rich repeat 502..525 CDD:275380 3/9 (33%)
leucine-rich repeat 526..547 CDD:275380
LRR_RI 548..791 CDD:238064
leucine-rich repeat 613..636 CDD:275380
LRR_8 615..671 CDD:290566
leucine-rich repeat 637..660 CDD:275380
LRR_8 660..743 CDD:290566
leucine-rich repeat 661..684 CDD:275380
leucine-rich repeat 685..708 CDD:275380
leucine-rich repeat 709..732 CDD:275380
leucine-rich repeat 733..756 CDD:275380
LRR_RI 735..1027 CDD:238064
leucine-rich repeat 757..780 CDD:275380
leucine-rich repeat 781..803 CDD:275380
leucine-rich repeat 804..827 CDD:275380
LRR_8 827..886 CDD:290566
leucine-rich repeat 828..851 CDD:275380
leucine-rich repeat 852..875 CDD:275380
leucine-rich repeat 876..899 CDD:275380
LRR_8 877..934 CDD:290566
leucine-rich repeat 900..923 CDD:275380
LRR_RI 902..1176 CDD:238064
LRR_8 922..982 CDD:290566
leucine-rich repeat 924..947 CDD:275380
leucine-rich repeat 948..968 CDD:275380
leucine-rich repeat 972..997 CDD:275380
LRR_8 997..1057 CDD:290566
leucine-rich repeat 998..1025 CDD:275380
leucine-rich repeat 1026..1070 CDD:275380
LRR_8 1045..1105 CDD:290566
leucine-rich repeat 1071..1094 CDD:275380
LRR_8 1093..1152 CDD:290566
leucine-rich repeat 1095..1117 CDD:275380
leucine-rich repeat 1118..1141 CDD:275380
LRR_8 1142..1197 CDD:290566
leucine-rich repeat 1142..1163 CDD:275380
leucine-rich repeat 1166..1187 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.