DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and AgaP_AGAP007457

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_308407.4 Gene:AgaP_AGAP007457 / 1269758 VectorBaseID:AGAP007457 Length:357 Species:Anopheles gambiae


Alignment Length:320 Identity:82/320 - (25%)
Similarity:123/320 - (38%) Gaps:99/320 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 SIFYHAQRLTVINMCDNQIQN---FPP-----NLLRDQLMLEELDMSRNKISELSSGSIRYLTKL 327
            :||...:||..|......:.|   |.|     ||:..:|.:|:||::.             ..||
Mosquito    42 AIFPPDERLVWIRNSTIPVFNRSLFTPLAHVENLMIHRLQIEQLDLAG-------------CDKL 93

  Fly   328 KTLDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNA 392
            ..|...:|.|.::..|  .|| .||.|.|:.||::.:|                          |
Mosquito    94 DILFASYNAIDRVSAD--EGL-PLRQLHLYQNRLTDVS--------------------------A 129

  Fly   393 FVELNNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNN-------LKIL 450
            ...|..:.:|:|.:|.:.|:..|.|..:..|..|||..|.|.|:..    |..|       |:.|
Mosquito   130 LRALTEIEQLYLHENLLESLRFDTFAPMRQLKILTLQRNRLRTIAT----GTGNKPLVMPRLEQL 190

  Fly   451 LLNNNILKNFDARAFEPLSQLEKLR---IDSNKLMFLPHGALHGLKNLVAVK---LDKNPWHCDC 509
            .|..|.|.:.|.    .|.::|:||   :..|:|.:|    |..|:.|.|::   |..|||||. 
Mosquito   191 FLQFNQLPHLDT----GLWRMERLRVLDVSHNQLAYL----LTFLEELPALRTLGLHHNPWHCG- 246

  Fly   510 RALYLARWIREFVLKLWDGQQPMCRGPGDLGGHEVGLLRYDD--LCDGQWASMLSLSPRL 567
                   |:...:.:|         |..:|.....||:..|:  .|.|     |.|..||
Mosquito   247 -------WLFGMLERL---------GARELDTDADGLIGIDEEASCPG-----LRLEDRL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566
leucine-rich repeat 187..206 CDD:275380
LRR_RI <201..386 CDD:238064 29/122 (24%)
leucine-rich repeat 207..230 CDD:275380
leucine-rich repeat 231..254 CDD:275380
LRR_8 253..313 CDD:290566 14/49 (29%)
leucine-rich repeat 255..278 CDD:275380 2/6 (33%)
leucine-rich repeat 279..302 CDD:275380 7/30 (23%)
LRR_8 303..361 CDD:290566 16/57 (28%)
leucine-rich repeat 303..326 CDD:275380 3/22 (14%)
leucine-rich repeat 327..350 CDD:275380 7/22 (32%)
LRR_8 349..407 CDD:290566 11/57 (19%)
LRR_4 350..390 CDD:289563 7/39 (18%)
leucine-rich repeat 351..374 CDD:275380 7/22 (32%)
leucine-rich repeat 375..398 CDD:275380 2/22 (9%)
LRR_8 398..>443 CDD:290566 13/44 (30%)
leucine-rich repeat 399..422 CDD:275380 6/22 (27%)
leucine-rich repeat 423..443 CDD:275380 7/19 (37%)
leucine-rich repeat 471..494 CDD:275380 8/25 (32%)
LRRCT 503..554 CDD:214507 12/52 (23%)
AgaP_AGAP007457XP_308407.4 leucine-rich repeat 50..71 CDD:275380 5/20 (25%)
leucine-rich repeat 72..92 CDD:275380 6/32 (19%)
leucine-rich repeat 93..108 CDD:275380 4/14 (29%)
LRR_8 114..170 CDD:290566 20/81 (25%)
LRR_4 114..149 CDD:289563 12/60 (20%)
leucine-rich repeat 114..135 CDD:275380 9/46 (20%)
leucine-rich repeat 136..159 CDD:275380 6/22 (27%)
LRR_8 158..220 CDD:290566 20/69 (29%)
leucine-rich repeat 160..186 CDD:275380 9/29 (31%)
leucine-rich repeat 187..209 CDD:275380 7/25 (28%)
leucine-rich repeat 210..232 CDD:275380 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.