| Sequence 1: | NP_647931.1 | Gene: | CG7509 / 38579 | FlyBaseID: | FBgn0035575 | Length: | 615 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_443204.1 | Gene: | LRG1 / 116844 | HGNCID: | 29480 | Length: | 347 | Species: | Homo sapiens |
| Alignment Length: | 258 | Identity: | 79/258 - (30%) |
|---|---|---|---|
| Similarity: | 116/258 - (44%) | Gaps: | 5/258 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 289 IQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRT 353
Fly 354 LSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFL 418
Fly 419 NVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMF 483
Fly 484 LPHG--ALHGLKN---LVAVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQPMCRGPGDLGG 541 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7509 | NP_647931.1 | LRR_8 | 182..241 | CDD:290566 | |
| leucine-rich repeat | 187..206 | CDD:275380 | |||
| LRR_RI | <201..386 | CDD:238064 | 30/96 (31%) | ||
| leucine-rich repeat | 207..230 | CDD:275380 | |||
| leucine-rich repeat | 231..254 | CDD:275380 | |||
| LRR_8 | 253..313 | CDD:290566 | 9/23 (39%) | ||
| leucine-rich repeat | 255..278 | CDD:275380 | |||
| leucine-rich repeat | 279..302 | CDD:275380 | 4/12 (33%) | ||
| LRR_8 | 303..361 | CDD:290566 | 18/57 (32%) | ||
| leucine-rich repeat | 303..326 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 327..350 | CDD:275380 | 5/22 (23%) | ||
| LRR_8 | 349..407 | CDD:290566 | 17/57 (30%) | ||
| LRR_4 | 350..390 | CDD:289563 | 13/39 (33%) | ||
| leucine-rich repeat | 351..374 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 375..398 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 398..>443 | CDD:290566 | 16/44 (36%) | ||
| leucine-rich repeat | 399..422 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 423..443 | CDD:275380 | 8/19 (42%) | ||
| leucine-rich repeat | 471..494 | CDD:275380 | 8/24 (33%) | ||
| LRRCT | 503..554 | CDD:214507 | 13/39 (33%) | ||
| LRG1 | NP_443204.1 | LRR_8 | 79..128 | CDD:290566 | 16/47 (34%) |
| LRR_RI | <82..248 | CDD:238064 | 51/165 (31%) | ||
| LRR 1 | 93..114 | 7/20 (35%) | |||
| leucine-rich repeat | 94..117 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 116..176 | CDD:290566 | 17/59 (29%) | ||
| LRR 2 | 117..138 | 5/20 (25%) | |||
| leucine-rich repeat | 118..141 | CDD:275380 | 5/22 (23%) | ||
| LRR 3 | 141..162 | 6/20 (30%) | |||
| leucine-rich repeat | 142..165 | CDD:275380 | 7/22 (32%) | ||
| LRR 4 | 165..186 | 6/20 (30%) | |||
| leucine-rich repeat | 166..189 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 169..224 | CDD:290566 | 18/54 (33%) | ||
| LRR 5 | 189..210 | 8/20 (40%) | |||
| leucine-rich repeat | 190..213 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 213..272 | CDD:290566 | 22/58 (38%) | ||
| LRR 6 | 213..234 | 8/20 (40%) | |||
| leucine-rich repeat | 214..237 | CDD:275380 | 8/22 (36%) | ||
| LRR 7 | 237..258 | 9/20 (45%) | |||
| leucine-rich repeat | 238..261 | CDD:275380 | 10/22 (45%) | ||
| LRR 8 | 261..282 | 7/20 (35%) | |||
| leucine-rich repeat | 262..285 | CDD:275380 | 7/22 (32%) | ||
| LRRCT | 299..346 | CDD:214507 | 13/39 (33%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165141288 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||