DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and amigo3

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_031756975.1 Gene:amigo3 / 116410456 -ID:- Length:509 Species:Xenopus tropicalis


Alignment Length:376 Identity:94/376 - (25%)
Similarity:132/376 - (35%) Gaps:105/376 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 GSQIEWNHCTSGVCRCNPDTKSFTCWNTNLKSVPVTQVIPMNMVNIDLSRNILSTLHKDTFRGLT 205
            |..|..| |.|. |.|..|..|  |...||..||  :.:|...|::|||.|.|:.||......|:
 Frog    41 GGSISLN-CPSS-CICASDLLS--CVRQNLHQVP--KPLPSTSVSLDLSHNNLTHLHNHWLTSLS 99

  Fly   206 VLKELDISHNVLDFLPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIGMLPE 270
            .|..|.:|||.:..:|...|.:..:|..|.:.:|.||||....|..|                  
 Frog   100 RLHTLRLSHNHIRQMPTHAFHNATALRHLDLSSNLLEDIREEWFKSL------------------ 146

  Fly   271 SIFYHAQRLTVINMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWN 335
                          |                .||||.:..|:|..:..|:..|||.::.:...||
 Frog   147 --------------C----------------KLEELLLYNNRIGFVDDGAFSYLTNIQKIYLSWN 181

  Fly   336 QIAKIDDDFFAGLRS--LRTLSLHNNR--------ISSLSGTIFNNL---ANLVTLDLTTNRI-S 386
            .::.........|.:  ||||.|.:||        :|:|...|.|.|   .|.:|.......: |
 Frog   182 LMSNFSFQSMQNLTNPHLRTLDLSSNRFLELPVEELSALPAFIKNGLYLHNNPLTCHCALYALFS 246

  Fly   387 HIDGNAFVELNNLNE----LFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGL--N 445
            |.|...|..:.:..|    |::|             |..|:.|:....|............|  |
 Frog   247 HWDNRGFSSVVDFFEAHTCLYMG-------------NPRAIVRILQTQNGFDNCSLGKLHRLPDN 298

  Fly   446 NLKIL------------LLNNN-----ILKNFDARAFEPLSQLEKLRIDSN 479
            .||:|            |...|     ||..::...| |.:....|||..|
 Frog   299 GLKVLVGKPLMMTCNTSLPQENTTYLWILPTYEFLVF-PGNSNRSLRIHHN 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 19/58 (33%)
leucine-rich repeat 187..206 CDD:275380 8/18 (44%)
LRR_RI <201..386 CDD:238064 45/198 (23%)
leucine-rich repeat 207..230 CDD:275380 7/22 (32%)
leucine-rich repeat 231..254 CDD:275380 9/22 (41%)
LRR_8 253..313 CDD:290566 6/59 (10%)
leucine-rich repeat 255..278 CDD:275380 0/22 (0%)
leucine-rich repeat 279..302 CDD:275380 1/22 (5%)
LRR_8 303..361 CDD:290566 20/67 (30%)
leucine-rich repeat 303..326 CDD:275380 9/22 (41%)
leucine-rich repeat 327..350 CDD:275380 3/22 (14%)
LRR_8 349..407 CDD:290566 21/75 (28%)
LRR_4 350..390 CDD:289563 16/53 (30%)
leucine-rich repeat 351..374 CDD:275380 12/33 (36%)
leucine-rich repeat 375..398 CDD:275380 5/23 (22%)
LRR_8 398..>443 CDD:290566 7/48 (15%)
leucine-rich repeat 399..422 CDD:275380 4/26 (15%)
leucine-rich repeat 423..443 CDD:275380 2/19 (11%)
leucine-rich repeat 471..494 CDD:275380 4/9 (44%)
LRRCT 503..554 CDD:214507
amigo3XP_031756975.1 leucine-rich repeat 59..79 CDD:275380 7/23 (30%)
LRR_8 79..135 CDD:404697 18/55 (33%)
leucine-rich repeat 80..100 CDD:275380 8/19 (42%)
leucine-rich repeat 101..124 CDD:275380 7/22 (32%)
LRR_8 125..183 CDD:404697 22/105 (21%)
leucine-rich repeat 125..148 CDD:275380 10/70 (14%)
leucine-rich repeat 149..172 CDD:275380 9/22 (41%)
leucine-rich repeat 173..196 CDD:275380 3/22 (14%)
leucine-rich repeat 199..222 CDD:275380 9/22 (41%)
IG 302..383 CDD:214652 11/48 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.