DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and lrg1

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_004911101.1 Gene:lrg1 / 116406453 XenbaseID:XB-GENE-984373 Length:372 Species:Xenopus tropicalis


Alignment Length:310 Identity:93/310 - (30%)
Similarity:140/310 - (45%) Gaps:19/310 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 NLNILDLSKNEIGMLPESIFYHAQRLTV-----INMCDNQIQNFPPNLLRDQLMLEELDMSRNKI 313
            |::::.:|: |:...|.|...|...::|     .::|:......|        .|:||.:|.|.:
 Frog    72 NISVVCISR-ELDSFPCSFPLHTISISVEFTNITSLCNGSFSELP--------NLQELHLSNNAL 127

  Fly   314 SELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLSGTIFNNLANLVTL 378
            ..|.......|:.|.|||...|.|..:....|..:.:||.|.|..|.::.|..:..:.|.||..|
 Frog   128 QSLPIQFFVPLSSLHTLDLTNNLIQSVTPTLFLDVPALRFLVLRGNLLTKLWISKISILKNLNWL 192

  Fly   379 DLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQG 443
            ||:.|.:..::..:|..||||..|.|..|.:..:|:.|...:..|.||.|..|||::|.:|.|..
 Frog   193 DLSHNHLKEVNSMSFSSLNNLENLDLSYNQLHQLPSSLLKGLPLLQRLNLEGNNLSSLPSDFFAA 257

  Fly   444 LNNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFLPHGAL---HGLKNLVAVKLD--KN 503
            ...||.:.|..|.|.........|:..|:.|.:..|.|..||.|.|   .||.:.:...||  .|
 Frog   258 TPFLKHVFLARNSLHFLPKGLLLPVMSLKTLDLSENMLKSLPSGFLLESKGLNDSMEQTLDLSNN 322

  Fly   504 PWHCDCRALYLARWIREFVLKLWDGQQPMCRGPGDLGGHEVGLLRYDDLC 553
            ||||||..|.|.:|:.:....|:......|.|||.|....:..:...|||
 Frog   323 PWHCDCHLLSLHQWVTKHKHTLYFIDNTQCAGPGALKNRTLHQVTEVDLC 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566
leucine-rich repeat 187..206 CDD:275380
LRR_RI <201..386 CDD:238064 36/136 (26%)
leucine-rich repeat 207..230 CDD:275380
leucine-rich repeat 231..254 CDD:275380 93/310 (30%)
LRR_8 253..313 CDD:290566 14/63 (22%)
leucine-rich repeat 255..278 CDD:275380 5/22 (23%)
leucine-rich repeat 279..302 CDD:275380 3/27 (11%)
LRR_8 303..361 CDD:290566 19/57 (33%)
leucine-rich repeat 303..326 CDD:275380 7/22 (32%)
leucine-rich repeat 327..350 CDD:275380 7/22 (32%)
LRR_8 349..407 CDD:290566 20/57 (35%)
LRR_4 350..390 CDD:289563 13/39 (33%)
leucine-rich repeat 351..374 CDD:275380 7/22 (32%)
leucine-rich repeat 375..398 CDD:275380 7/22 (32%)
LRR_8 398..>443 CDD:290566 17/44 (39%)
leucine-rich repeat 399..422 CDD:275380 6/22 (27%)
leucine-rich repeat 423..443 CDD:275380 10/19 (53%)
leucine-rich repeat 471..494 CDD:275380 10/25 (40%)
LRRCT 503..554 CDD:214507 19/51 (37%)
lrg1XP_004911101.1 LRR_RI 115..322 CDD:238064 66/214 (31%)
LRR_8 115..175 CDD:290566 20/67 (30%)
leucine-rich repeat 117..140 CDD:275380 7/22 (32%)
leucine-rich repeat 141..164 CDD:275380 7/22 (32%)
leucine-rich repeat 165..188 CDD:275380 7/22 (32%)
LRR_8 187..247 CDD:290566 21/59 (36%)
leucine-rich repeat 189..212 CDD:275380 7/22 (32%)
leucine-rich repeat 213..236 CDD:275380 6/22 (27%)
LRR_8 235..295 CDD:290566 19/59 (32%)
leucine-rich repeat 237..260 CDD:275380 10/22 (45%)
leucine-rich repeat 261..284 CDD:275380 6/22 (27%)
LRRCT 322..372 CDD:214507 17/49 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.