DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and lrfn4a

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_005161420.1 Gene:lrfn4a / 101882983 ZFINID:ZDB-GENE-091113-56 Length:892 Species:Danio rerio


Alignment Length:345 Identity:85/345 - (24%)
Similarity:140/345 - (40%) Gaps:67/345 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 MCDNQIQNF-PPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAG 347
            :|.|:...| |||:.|..:   ||.::.|.|.|:....                        ||.
Zfish    97 LCVNKGLLFVPPNIDRRTV---ELRLADNYILEVGGAD------------------------FAN 134

  Fly   348 LRSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSI 412
            :..|..|:|..|.|.:|....|.:|.:|.:|.|.|||::.:.......|.||..|.:..|.::.:
Zfish   135 MTGLVDLTLSRNTIHALKPLAFADLESLRSLHLDTNRLTVVGPQDLTGLVNLQHLIINNNQLTDV 199

  Fly   413 PADLFLN-VSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRI 476
            .||.|.: :..|..|.|..|||..:..:..|.:.:|..|.|::|::......:|..|.:|.:|.:
Zfish   200 SADAFDDFLLTLEDLDLSYNNLRRVPWESIQNMASLHTLNLDHNLIDQIAEGSFGELYKLSRLDM 264

  Fly   477 DSNKLMFLPHGALHG-----------LKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQ 530
            .||:|..||...|..           ..::.::....||.||:|..|:|.|.|||       ...
Zfish   265 TSNRLQTLPPDPLFSRSQIGVVSPTPYNSITSLNFGGNPLHCNCELLWLRRLIRE-------DDM 322

  Fly   531 PMCRGPGDLGGHEVGLLRYDD----------------LCDGQWASM--LSLSPRLPVRKHQISTP 577
            ..|..|..|.|.....:..::                :.:||.|::  .::....|| .|.:| |
Zfish   323 ETCATPAHLAGRYFWSIPEEEFTCEPPLITRNTNKLWVLEGQRATLKCRAIGDPEPV-IHWVS-P 385

  Fly   578 MNYTDYFNLYLKHIYNGTTD 597
            .:.....:..::..||||.|
Zfish   386 DDRIVANSSRIRSYYNGTLD 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566
leucine-rich repeat 187..206 CDD:275380
LRR_RI <201..386 CDD:238064 28/102 (27%)
leucine-rich repeat 207..230 CDD:275380
leucine-rich repeat 231..254 CDD:275380
LRR_8 253..313 CDD:290566 10/29 (34%)
leucine-rich repeat 255..278 CDD:275380
leucine-rich repeat 279..302 CDD:275380 7/18 (39%)
LRR_8 303..361 CDD:290566 11/57 (19%)
leucine-rich repeat 303..326 CDD:275380 5/22 (23%)
leucine-rich repeat 327..350 CDD:275380 2/22 (9%)
LRR_8 349..407 CDD:290566 18/57 (32%)
LRR_4 350..390 CDD:289563 14/39 (36%)
leucine-rich repeat 351..374 CDD:275380 8/22 (36%)
leucine-rich repeat 375..398 CDD:275380 7/22 (32%)
LRR_8 398..>443 CDD:290566 13/45 (29%)
leucine-rich repeat 399..422 CDD:275380 6/23 (26%)
leucine-rich repeat 423..443 CDD:275380 6/19 (32%)
leucine-rich repeat 471..494 CDD:275380 8/33 (24%)
LRRCT 503..554 CDD:214507 15/66 (23%)
lrfn4aXP_005161420.1 LRR_RI 102..>269 CDD:238064 51/193 (26%)
leucine-rich repeat 114..137 CDD:275380 7/49 (14%)
LRR_8 136..196 CDD:290566 19/59 (32%)
leucine-rich repeat 138..161 CDD:275380 8/22 (36%)
leucine-rich repeat 162..185 CDD:275380 7/22 (32%)
LRR_8 185..245 CDD:290566 18/59 (31%)
leucine-rich repeat 186..210 CDD:275380 6/23 (26%)
leucine-rich repeat 211..234 CDD:275380 7/22 (32%)
LRR_8 234..304 CDD:290566 15/69 (22%)
leucine-rich repeat 235..258 CDD:275380 6/22 (27%)
leucine-rich repeat 259..282 CDD:275380 8/22 (36%)
LRRCT 302..346 CDD:214507 15/50 (30%)
IG_like 358..436 CDD:214653 13/50 (26%)
Ig 363..436 CDD:299845 13/45 (29%)
fn3 501..579 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1378
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.