DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and waif2

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:NP_001245160.1 Gene:waif2 / 100884149 ZFINID:ZDB-GENE-120209-3 Length:313 Species:Danio rerio


Alignment Length:207 Identity:62/207 - (29%)
Similarity:83/207 - (40%) Gaps:44/207 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 TKLKTLDFGWNQIAKIDDDFFA---GLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRIS 386
            |::.||: ..|....|:..|.|   ...||..|||.:|.|..:....|..|..|..|||:.||:.
Zfish    41 TQILTLN-NVNMSVLIERAFSANGTNAHSLHELSLRDNNIQVIQSCAFCGLHRLHLLDLSRNRLE 104

  Fly   387 HIDGNAFVELNNLNELFL-------GQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGL 444
            .:...||.|||.|..|.|       |.|.:||....|    |.|..|.|..|.|.|:....| |.
Zfish   105 DVHPEAFSELNQLRNLNLSYTLTAAGANQLSSALDSL----SNLQILDLSGNRLKTIPLSGF-GK 164

  Fly   445 NNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDC 509
            .:|.:|.|.:|.:...|......||:..::|:      :|.|                ||:.|.|
Zfish   165 FSLTMLNLTHNSITTLDTNELTKLSEYREMRV------YLSH----------------NPFDCRC 207

  Fly   510 RALYLARWIREF 521
            ..|      |||
Zfish   208 DRL------REF 213

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566
leucine-rich repeat 187..206 CDD:275380
LRR_RI <201..386 CDD:238064 22/63 (35%)
leucine-rich repeat 207..230 CDD:275380
leucine-rich repeat 231..254 CDD:275380
LRR_8 253..313 CDD:290566
leucine-rich repeat 255..278 CDD:275380
leucine-rich repeat 279..302 CDD:275380
LRR_8 303..361 CDD:290566 13/38 (34%)