DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and rtn4rl2

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_017951401.1 Gene:rtn4rl2 / 100498486 XenbaseID:XB-GENE-6036061 Length:396 Species:Xenopus tropicalis


Alignment Length:303 Identity:100/303 - (33%)
Similarity:137/303 - (45%) Gaps:46/303 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 LPESIFYHAQRLTVINMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDF 332
            ||.|    ||||.:.|   |.|....|.|...  :...|.:..|.||.|..|:...|..|:.||.
 Frog    65 LPSS----AQRLFLQN---NHISEIGPGLFSP--LTSVLWLFSNHISILHPGAFNGLENLEELDL 120

  Fly   333 GWN-QIAKIDDDFFAGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVEL 396
            |.| :...:..|.|.||:|||:|.|::..|:.|...:|..|.:|..|.|..||::.:....|.:|
 Frog   121 GNNPKFPILQSDTFEGLKSLRSLHLYHCHINRLPSGLFRGLYSLRYLYLQNNRLTVLPDGLFRDL 185

  Fly   397 NNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFD 461
            .||.:|||..|.:.|:||:.|..:|.|.||.|.||.|..:....|:||.:|.:|.|.||.|....
 Frog   186 FNLTQLFLYGNLLQSLPAESFFGLSNLDRLLLHSNQLAVVSPGAFRGLKSLTMLYLFNNSLPTLP 250

  Fly   462 ARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLW 526
            ....:||:.|:.||                        |::|||||||....|.||   |.....
 Frog   251 GDCLQPLTSLQFLR------------------------LNENPWHCDCSCRSLWRW---FHSTPG 288

  Fly   527 DGQQPM-CRGPGDLGGHEVGLLRYDDL--CDGQWASMLSLSPR 566
            ....|: |..|..|.|.::..|...||  |..      ::|||
 Frog   289 VSSSPVTCNSPPPLKGRDLRFLVERDLRFCTS------NISPR 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566
leucine-rich repeat 187..206 CDD:275380
LRR_RI <201..386 CDD:238064 42/118 (36%)
leucine-rich repeat 207..230 CDD:275380
leucine-rich repeat 231..254 CDD:275380
LRR_8 253..313 CDD:290566 14/44 (32%)
leucine-rich repeat 255..278 CDD:275380 4/9 (44%)
leucine-rich repeat 279..302 CDD:275380 6/22 (27%)
LRR_8 303..361 CDD:290566 21/58 (36%)
leucine-rich repeat 303..326 CDD:275380 7/22 (32%)
leucine-rich repeat 327..350 CDD:275380 9/23 (39%)
LRR_8 349..407 CDD:290566 21/57 (37%)
LRR_4 350..390 CDD:289563 14/39 (36%)
leucine-rich repeat 351..374 CDD:275380 8/22 (36%)
leucine-rich repeat 375..398 CDD:275380 7/22 (32%)
LRR_8 398..>443 CDD:290566 19/44 (43%)
leucine-rich repeat 399..422 CDD:275380 9/22 (41%)
leucine-rich repeat 423..443 CDD:275380 8/19 (42%)
leucine-rich repeat 471..494 CDD:275380 3/22 (14%)
LRRCT 503..554 CDD:214507 19/53 (36%)
rtn4rl2XP_017951401.1 PLN00113 46..>268 CDD:215061 77/235 (33%)
leucine-rich repeat 69..92 CDD:275380 9/27 (33%)
leucine-rich repeat 93..114 CDD:275380 7/20 (35%)
leucine-rich repeat 115..139 CDD:275380 9/23 (39%)
leucine-rich repeat 140..163 CDD:275380 8/22 (36%)
LRR_8 163..222 CDD:338972 24/58 (41%)
leucine-rich repeat 164..187 CDD:275380 7/22 (32%)
leucine-rich repeat 188..211 CDD:275380 9/22 (41%)
leucine-rich repeat 212..235 CDD:275380 10/22 (45%)
leucine-rich repeat 236..259 CDD:275380 8/22 (36%)
TPKR_C2 268..310 CDD:387596 16/44 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D595054at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.