DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and lingo3

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_004911049.2 Gene:lingo3 / 100497438 XenbaseID:XB-GENE-6051175 Length:605 Species:Xenopus tropicalis


Alignment Length:401 Identity:108/401 - (26%)
Similarity:193/401 - (48%) Gaps:34/401 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 EWN--HCTSGVCRCNPDTKSFTCWNTNLKSVPVTQVIPMNMVNIDLSRNILSTLHKDTFRGLTVL 207
            ||.  .|.:. |.|.|:.:|..|....|.::|  :.||.....:|||:|.:..|:...|...::|
 Frog    24 EWKVLGCPAR-CDCTPNQRSVICHRKRLTTIP--EGIPSETRLLDLSKNRIRCLNPGDFSPYSLL 85

  Fly   208 KELDISHNVLDFLPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIGMLPESI 272
            :|:|:|.|::..:....|.:|..|.:|:::.|||:.|....|.||.||.:||:|:|:|.:|.:.:
 Frog    86 EEVDLSENIISTIEPGAFANLFFLQILKLKGNQLKLIPTGVFTKLSNLTLLDISENKIVILLDFM 150

  Fly   273 FYHAQRLTVINMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQI 337
            |...:.|..:.:.||.:...........:.|::|.:.:..::.:|..|:.||..|:.|...:..|
 Frog   151 FQDLRSLKSLEVGDNDLLYISQKAFYGLVSLDQLTIEKCNLTSISPESLSYLQGLEVLRLRYLGI 215

  Fly   338 AKIDDDFFAGLRSLRTLSLHN-NRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNE 401
            ..:::..|..|.:|:.|.|.: ..:..:..|.|..| ||.:|.:|...::.:...|...:..|..
 Frog   216 NSLEEQNFQKLYNLKELELESWPLLEDVCNTAFQGL-NLTSLSITYTNLTSVPSAALRNMVYLEY 279

  Fly   402 LFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFE 466
            |.|..|.:..|....|.::..|..|.:....|:|:|:..|.||..:::|.::||:|...:..||:
 Frog   280 LNLSFNPIRIIQRGAFKDLVRLRELHIVGAFLSTVESQAFLGLRQIRLLNVSNNLLATLEESAFQ 344

  Fly   467 PLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQP 531
            .::.||.||:|.                        ||..||||.|::.:  |...|. :|..||
 Frog   345 SVNTLETLRVDD------------------------NPLACDCRLLWILQ--RRKTLN-FDNHQP 382

  Fly   532 MCRGPGDLGGH 542
            :|..|..:.|:
 Frog   383 VCASPAKIQGN 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 16/58 (28%)
leucine-rich repeat 187..206 CDD:275380 6/18 (33%)
LRR_RI <201..386 CDD:238064 50/185 (27%)
leucine-rich repeat 207..230 CDD:275380 7/22 (32%)
leucine-rich repeat 231..254 CDD:275380 9/22 (41%)
LRR_8 253..313 CDD:290566 14/59 (24%)
leucine-rich repeat 255..278 CDD:275380 8/22 (36%)
leucine-rich repeat 279..302 CDD:275380 3/22 (14%)
LRR_8 303..361 CDD:290566 14/58 (24%)
leucine-rich repeat 303..326 CDD:275380 6/22 (27%)
leucine-rich repeat 327..350 CDD:275380 5/22 (23%)
LRR_8 349..407 CDD:290566 14/58 (24%)
LRR_4 350..390 CDD:289563 10/40 (25%)
leucine-rich repeat 351..374 CDD:275380 6/23 (26%)
leucine-rich repeat 375..398 CDD:275380 4/22 (18%)
LRR_8 398..>443 CDD:290566 12/44 (27%)
leucine-rich repeat 399..422 CDD:275380 6/22 (27%)
leucine-rich repeat 423..443 CDD:275380 6/19 (32%)
leucine-rich repeat 471..494 CDD:275380 5/22 (23%)
LRRCT 503..554 CDD:214507 15/40 (38%)
lingo3XP_004911049.2 LRR 41..359 CDD:227223 88/344 (26%)
leucine-rich repeat 61..84 CDD:275380 6/22 (27%)
leucine-rich repeat 85..108 CDD:275380 7/22 (32%)
leucine-rich repeat 109..132 CDD:275380 9/22 (41%)
leucine-rich repeat 133..156 CDD:275380 8/22 (36%)
leucine-rich repeat 157..180 CDD:275380 3/22 (14%)
leucine-rich repeat 181..204 CDD:275380 6/22 (27%)
leucine-rich repeat 205..228 CDD:275380 5/22 (23%)
leucine-rich repeat 229..252 CDD:275380 6/23 (26%)
leucine-rich repeat 253..276 CDD:275380 4/22 (18%)
leucine-rich repeat 277..298 CDD:275380 6/20 (30%)
leucine-rich repeat 301..324 CDD:275380 8/22 (36%)
leucine-rich repeat 325..345 CDD:275380 6/19 (32%)
PCC 329..>399 CDD:188093 25/92 (27%)
Ig 413..502 CDD:416386
Ig strand A' 419..423 CDD:409353
Ig strand B 429..438 CDD:409353
Ig strand C 443..448 CDD:409353
Ig strand C' 451..453 CDD:409353
Ig strand D 462..465 CDD:409353
Ig strand E 468..475 CDD:409353
Ig strand F 481..489 CDD:409353
Ig strand G 492..502 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6410
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.