DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and slitrk4

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_004916941.2 Gene:slitrk4 / 100497316 XenbaseID:XB-GENE-983538 Length:851 Species:Xenopus tropicalis


Alignment Length:621 Identity:142/621 - (22%)
Similarity:234/621 - (37%) Gaps:205/621 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 PVWHLATGSQIEWNHCTSGVCRC----------------------NPDTKSFTCWN--TNLKSV- 173
            |:......|::....|  .||.|                      .|...:|...|  .||..: 
 Frog    27 PISSTNPDSELSLEIC--NVCSCLSVENVMYVNCEKVALYRPNQLKPPPSNFYHLNFQNNLLIIL 89

  Fly   174 -PVTQVIPMNMVNIDLSRNILSTLHKDTFRGLTVLKELDISHNVLDFLPFDLFQDLDSLLVLRIQ 237
             |.|.:...:.|::.|..|.|..:....|:||:.||:|.:::|.|..|..|.|..:::|..|:..
 Frog    90 YPNTFLNFTHAVSLQLGNNKLQNIEGGAFQGLSALKQLHLNNNELKVLRADTFLGIENLEYLQAD 154

  Fly   238 NNQLEDIDHRTFWKLRNLNILDLSKNEIGMLPESIFYHAQRLTVINMCDNQIQNFP--------- 293
            .|.::.|:...|.||..|.:|.|:.|.|..||::||..|. ||.:::..|:||..|         
 Frog   155 YNLIKYIERGAFNKLHKLKVLILNDNLISALPDNIFRFAS-LTHLDIRGNRIQKMPYIGVLEHIG 218

  Fly   294 ----------P-----NLLRDQLMLEEL-----------------------DMSRNKISELSSGS 320
                      |     :||..:..||.:                       :.::.::..:.:||
 Frog   219 RVVELQLEDNPWNCTCDLLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCSMGTGS 283

  Fly   321 ---------------------------IRYLTKL-KTLDFGWNQIAKIDDDFFAGLRSLRTLSLH 357
                                       .|.:||. ||.:...|          :|:.|.:::|.|
 Frog   284 DFDVRILPPSMETTFTTPGGQPAQTSLHRLVTKAPKTTNPSKN----------SGIVSGKSVSNH 338

  Fly   358 N--------NRISSLS---------------GTIFN-------NLANLV-------TLDLTTNRI 385
            :        .||...|               |...|       ::|.|:       .|.:..|.|
 Frog   339 SLSQIVSFQTRIPPFSPCPSPCMCKTYPSDLGLSVNCQERNIKSMAELIPKPLNAKKLHVNGNYI 403

  Fly   386 SHIDGNAFVELNNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLN----- 445
            .|::.:.||:...|:.|.||.|.:::|..::|.|::.|.||.|..|.:..|..:.|.||:     
 Frog   404 KHVEQSDFVDFEGLDLLHLGSNQLTNIQGNVFCNLTNLRRLYLNGNQIERLSPEIFAGLHNLQYL 468

  Fly   446 -------------------NLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFLP-HGALH 490
                               ||::|.||||:|::..|..|..: .|.:|.|.:|..|:|| .|.|.
 Frog   469 YLEYNIIKEILGGTFESMPNLQLLYLNNNLLRSLPAYIFSGV-PLARLNIRNNHFMYLPVSGVLD 532

  Fly   491 GLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWDG---QQPMCRGPGDLGGHEVGLLRYDDL 552
            .|::|..:.|:.|||.|.|..:.|..|:.    ||.:|   ::..|..|......|:..|:.:.|
 Frog   533 QLRSLTQIDLEGNPWDCTCDLVALKLWLE----KLSEGIVMKEVKCETPVQFANIELRSLKNEIL 593

  Fly   553 CDGQWASMLSLSPRL----------PVRKHQISTPM 578
            |           |:|          ||.....:||:
 Frog   594 C-----------PKLINKPPTQYTSPVPAVTFTTPL 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 18/58 (31%)
leucine-rich repeat 187..206 CDD:275380 6/18 (33%)
LRR_RI <201..386 CDD:238064 60/296 (20%)
leucine-rich repeat 207..230 CDD:275380 8/22 (36%)
leucine-rich repeat 231..254 CDD:275380 7/22 (32%)
LRR_8 253..313 CDD:290566 21/106 (20%)
leucine-rich repeat 255..278 CDD:275380 10/22 (45%)
leucine-rich repeat 279..302 CDD:275380 9/46 (20%)
LRR_8 303..361 CDD:290566 14/116 (12%)
leucine-rich repeat 303..326 CDD:275380 5/72 (7%)
leucine-rich repeat 327..350 CDD:275380 4/23 (17%)
LRR_8 349..407 CDD:290566 20/94 (21%)
LRR_4 350..390 CDD:289563 14/76 (18%)
leucine-rich repeat 351..374 CDD:275380 7/52 (13%)
leucine-rich repeat 375..398 CDD:275380 7/29 (24%)
LRR_8 398..>443 CDD:290566 15/44 (34%)
leucine-rich repeat 399..422 CDD:275380 8/22 (36%)
leucine-rich repeat 423..443 CDD:275380 7/19 (37%)
leucine-rich repeat 471..494 CDD:275380 10/23 (43%)
LRRCT 503..554 CDD:214507 15/53 (28%)
slitrk4XP_004916941.2 internalin_A <30..>268 CDD:380193 55/240 (23%)
leucine-rich repeat 78..99 CDD:275380 5/20 (25%)
LRR_8 102..158 CDD:404697 17/55 (31%)
leucine-rich repeat 102..123 CDD:275380 6/20 (30%)
leucine-rich repeat 124..147 CDD:275380 8/22 (36%)
LRR_8 147..205 CDD:404697 20/58 (34%)
leucine-rich repeat 148..171 CDD:275380 7/22 (32%)
leucine-rich repeat 172..194 CDD:275380 9/21 (43%)
leucine-rich repeat 195..219 CDD:275380 6/23 (26%)
leucine-rich repeat 220..312 CDD:275380 7/91 (8%)
leucine-rich repeat 313..416 CDD:275380 22/112 (20%)
leucine-rich repeat 372..392 CDD:275380 3/19 (16%)
PPP1R42 373..546 CDD:411060 48/173 (28%)
LRR_8 416..473 CDD:404697 17/56 (30%)
leucine-rich repeat 417..440 CDD:275380 8/22 (36%)
leucine-rich repeat 441..464 CDD:275380 9/22 (41%)
leucine-rich repeat 465..486 CDD:275380 0/20 (0%)
leucine-rich repeat 489..510 CDD:275380 9/20 (45%)
leucine-rich repeat 512..536 CDD:275380 10/23 (43%)
TPKR_C2 545..>577 CDD:417692 11/35 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.