DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and lrrc15

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_031758235.1 Gene:lrrc15 / 100496322 XenbaseID:XB-GENE-990725 Length:588 Species:Xenopus tropicalis


Alignment Length:440 Identity:117/440 - (26%)
Similarity:187/440 - (42%) Gaps:60/440 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 WNHCTSGVCRCNPDTKSFTCWNTNLKSVPVTQVIPMN---------MVNID-------------- 187
            :..|.|. |.| |......|      |.|...|||.|         :||.:              
 Frog    20 YGQCPSD-CIC-PRPGQVDC------SGPEVLVIPDNIPQNIRTLQIVNTEVTELPNGILQNMTA 76

  Fly   188 -----LSRNILSTLHKDTFRGLTVLKELDISHNVLDFLPFDLFQDLDSLLVLRIQNNQLEDIDHR 247
                 :.:|.|||:....|..|..|:.|.:::|.|..|..:||:||..|..|.:.|||:..|...
 Frog    77 LLILRIEKNELSTVGSTAFHNLISLRYLSLANNKLQELHGNLFKDLAKLETLILSNNQINQIHPS 141

  Fly   248 TFWKLRNLNILDLSKNEIGMLPESIFYHAQRLTVINMCDNQIQNFPPNLLRDQLMLEELDMSRNK 312
            .|..|.|:..|.:..|.:..:|...|.....|..:|:..|.|:..||........|:.|.:..|:
 Frog   142 LFTALSNVKDLQMVGNNLESIPVGAFDQMSGLLKLNLAKNSIKYLPPQAFDKLAKLQTLRLYENQ 206

  Fly   313 ISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLSGTIFNNLANLVT 377
            :.::.:|.::.|:.|:.:....|::.::..|.|:|...|:.:.|.||.|.||...||.||..:..
 Frog   207 LQDIPAGFLKKLSSLQEVALHSNKLIELSTDTFSGNPYLQKVFLSNNEIDSLPRGIFLNLPEITK 271

  Fly   378 LDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQ 442
            |.|..|.:..:....|..:..|.||:|..|.:..:..::|.|::....|.:..|.:.::....|.
 Frog   272 LTLYGNALRELTTGVFGPMPKLKELWLYDNQLEQLTDNVFSNLTETVLLVISKNKIRSISTHAFC 336

  Fly   443 GLNNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFL----------------------- 484
            ||..|:.|.|:.|:|...|....:.|.:|:.:.:.|||:.:|                       
 Frog   337 GLEELQELSLHTNLLTTLDQDVLKCLPKLQNISLHSNKIQYLPGDLFKNMDTVMNIQLQNNSLED 401

  Fly   485 -PHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQPMC 533
             ||.....|..|..|||.:|||.||...|.|..|:.|.:.||.:..|.:|
 Frog   402 IPHDFFDSLVQLNEVKLYENPWKCDHNLLSLKNWLSENMNKLGNLSQLVC 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 22/86 (26%)
leucine-rich repeat 187..206 CDD:275380 6/37 (16%)
LRR_RI <201..386 CDD:238064 54/184 (29%)
leucine-rich repeat 207..230 CDD:275380 9/22 (41%)
leucine-rich repeat 231..254 CDD:275380 8/22 (36%)
LRR_8 253..313 CDD:290566 14/59 (24%)
leucine-rich repeat 255..278 CDD:275380 4/22 (18%)
leucine-rich repeat 279..302 CDD:275380 6/22 (27%)
LRR_8 303..361 CDD:290566 14/57 (25%)
leucine-rich repeat 303..326 CDD:275380 5/22 (23%)
leucine-rich repeat 327..350 CDD:275380 5/22 (23%)
LRR_8 349..407 CDD:290566 19/57 (33%)
LRR_4 350..390 CDD:289563 14/39 (36%)
leucine-rich repeat 351..374 CDD:275380 11/22 (50%)
leucine-rich repeat 375..398 CDD:275380 4/22 (18%)
LRR_8 398..>443 CDD:290566 10/44 (23%)
leucine-rich repeat 399..422 CDD:275380 7/22 (32%)
leucine-rich repeat 423..443 CDD:275380 3/19 (16%)
leucine-rich repeat 471..494 CDD:275380 8/46 (17%)
LRRCT 503..554 CDD:214507 13/31 (42%)
lrrc15XP_031758235.1 leucine-rich repeat 35..51 CDD:275380 7/21 (33%)
LRR_8 51..111 CDD:404697 11/59 (19%)
leucine-rich repeat 54..76 CDD:275380 2/21 (10%)
leucine-rich repeat 77..100 CDD:275380 6/22 (27%)
internalin_A 98..>449 CDD:380193 96/350 (27%)
leucine-rich repeat 101..124 CDD:275380 9/22 (41%)
leucine-rich repeat 125..148 CDD:275380 8/22 (36%)
leucine-rich repeat 149..172 CDD:275380 4/22 (18%)
leucine-rich repeat 173..196 CDD:275380 6/22 (27%)
leucine-rich repeat 197..220 CDD:275380 5/22 (23%)
leucine-rich repeat 221..244 CDD:275380 5/22 (23%)
leucine-rich repeat 245..268 CDD:275380 11/22 (50%)
leucine-rich repeat 269..292 CDD:275380 4/22 (18%)
leucine-rich repeat 293..316 CDD:275380 7/22 (32%)
leucine-rich repeat 317..340 CDD:275380 5/22 (23%)
leucine-rich repeat 341..362 CDD:275380 6/20 (30%)
leucine-rich repeat 365..388 CDD:275380 5/22 (23%)
leucine-rich repeat 389..410 CDD:275380 2/20 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D595054at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47585
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.