DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and LOC100495962

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_004912402.2 Gene:LOC100495962 / 100495962 -ID:- Length:1055 Species:Xenopus tropicalis


Alignment Length:618 Identity:146/618 - (23%)
Similarity:225/618 - (36%) Gaps:205/618 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IVSQLLMLINSMPNGTQSAANDKKPPKSKANGHNDGDVNGGEINAMSHLANFDLVKRVRQ----- 123
            :|..:|:..||:.....:..|...|.|...||.:               .:||...|..|     
 Frog    23 LVLVVLITCNSLECSDTNPNNRTIPCKIAENGSS---------------VSFDCSARWLQMVPYP 72

  Fly   124 IESRLRSVEQPV---------------WHLATGSQIEWNH-----------CTSG---------- 152
            |:....|||..:               ||..|...:.|||           |..|          
 Frog    73 IKYSSDSVELLLSQNLILTINNESFHSWHNLTKIDLNWNHYPKSRLDNADICKRGLEIENGTFSY 137

  Fly   153 -------------VCRCN---PDTKSFTCWN-TNLKSVPVTQVIPM-NMVNIDLSRNI------- 192
                         :|:..   |.|.:|...: .|:.||....:.|: |:.|:.||.|.       
 Frog   138 LTKLEKLFIDHNYLCKIPQGIPSTLTFLSLSYNNIFSVKKQILSPLINLKNLFLSNNCYFGNECG 202

  Fly   193 -LSTLHKDTFRGLTVLKELDISHNVLDFLPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWKLRNLN 256
             :..:.:.||.|||.|.||.:|.|.|..:|..|   ..||..|.:.||.::.|:...|..|.||.
 Frog   203 QVLDIEEGTFSGLTELTELSLSFNNLTHVPSKL---PASLKQLYLSNNNIQIINRNDFHNLVNLE 264

  Fly   257 ILDLS-------------KNEIGMLPES-------IFYHAQRLTVINMCDNQIQNFPPNLLRDQL 301
            :|.||             ||   :.|.:       .|.:.:.||.:::....::..||...::..
 Frog   265 VLYLSGNCPRCFNANYPCKN---LCPNTSITIDHFAFQNLKNLTELHLSSTSLKTIPPTWFQNTT 326

  Fly   302 MLEELDMSRN-KISELSSGS-IRYLTKLKTLDFGWNQIAK-----ID-DDFFAGLRSLRTLSLHN 358
            .|::|.:.|| .::|::|.. :..|..|:.||..:|...:     |: .|.|:.|.||:  .|| 
 Frog   327 QLKKLYLERNYLVNEIASADFLLNLPFLEVLDLSFNYDLRSYTNNINISDHFSKLVSLK--ELH- 388

  Fly   359 NRISSLSGTIF-----NNLANLVT------LDLTTNRISHIDGNAFVELNNLNELFLGQNSMS-- 410
                 :.|.:|     ||||.|:.      |:|.||.|..:|...|.:...|..::|.:|.::  
 Frog   389 -----IQGYVFKHIAANNLAPLLNLSKLKILNLGTNFIRQVDFKIFQQFTGLELIYLSENRITPF 448

  Fly   411 -------------------------SIPA-------------------------DLFLN------ 419
                                     |.|.                         ||.||      
 Frog   449 SEKNNKMKLVEGYEDKHSRVSSPGVSFPTQFNFQMTKTFSEVVKPQCSSRGKTLDLSLNSIFFID 513

  Fly   420 ------VSALTRLTLFSNNL-TTLEADDFQGLNNLKILLLNNNILKNFDA-RAFEPLSQLEKLRI 476
                  .|.::.|.|.||.: ..|...:|..|.||..|.|:.|.| :||: .||:.|..||.|.:
 Frog   514 PKEFRSFSDVSCLNLSSNGIGQDLNGTEFIYLKNLTYLDLSFNKL-DFDSINAFQELPSLEVLDL 577

  Fly   477 DSNKLMFLPHGALHGLK---NLVAVKLDKNPWH 506
            ..|...|:..|.:|.||   ||..:|:....|:
 Frog   578 SYNSHYFIVDGVIHSLKFIENLQHLKVLNLSWN 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 23/66 (35%)
leucine-rich repeat 187..206 CDD:275380 7/26 (27%)
LRR_RI <201..386 CDD:238064 63/223 (28%)
leucine-rich repeat 207..230 CDD:275380 8/22 (36%)
leucine-rich repeat 231..254 CDD:275380 7/22 (32%)
LRR_8 253..313 CDD:290566 17/80 (21%)
leucine-rich repeat 255..278 CDD:275380 8/42 (19%)
leucine-rich repeat 279..302 CDD:275380 4/22 (18%)
LRR_8 303..361 CDD:290566 19/65 (29%)
leucine-rich repeat 303..326 CDD:275380 7/24 (29%)
leucine-rich repeat 327..350 CDD:275380 8/28 (29%)
LRR_8 349..407 CDD:290566 20/68 (29%)
LRR_4 350..390 CDD:289563 16/50 (32%)
leucine-rich repeat 351..374 CDD:275380 8/27 (30%)
leucine-rich repeat 375..398 CDD:275380 8/28 (29%)
LRR_8 398..>443 CDD:290566 16/109 (15%)
leucine-rich repeat 399..422 CDD:275380 9/86 (10%)
leucine-rich repeat 423..443 CDD:275380 6/20 (30%)
leucine-rich repeat 471..494 CDD:275380 9/25 (36%)
LRRCT 503..554 CDD:214507 1/4 (25%)
LOC100495962XP_004912402.2 LRR_8 81..151 CDD:404697 9/69 (13%)
leucine-rich repeat 81..102 CDD:275380 2/20 (10%)
leucine-rich repeat 103..140 CDD:275380 6/36 (17%)
leucine-rich repeat 141..160 CDD:275380 1/18 (6%)
PLN00113 153..>580 CDD:215061 110/441 (25%)
leucine-rich repeat 162..185 CDD:275380 5/22 (23%)
leucine-rich repeat 186..217 CDD:275380 8/30 (27%)
leucine-rich repeat 218..262 CDD:275380 16/46 (35%)
leucine-rich repeat 263..303 CDD:275380 8/42 (19%)
leucine-rich repeat 304..327 CDD:275380 4/22 (18%)
leucine-rich repeat 328..353 CDD:275380 7/24 (29%)
leucine-rich repeat 354..383 CDD:275380 8/28 (29%)
leucine-rich repeat 384..410 CDD:275380 10/33 (30%)
leucine-rich repeat 411..434 CDD:275380 7/22 (32%)
leucine-rich repeat 500..522 CDD:275380 4/21 (19%)
leucine-rich repeat 526..547 CDD:275380 7/20 (35%)
PPP1R42 545..788 CDD:411060 25/67 (37%)
leucine-rich repeat 548..571 CDD:275380 10/23 (43%)
leucine-rich repeat 572..601 CDD:275380 11/28 (39%)
leucine-rich repeat 602..624 CDD:275380 2/9 (22%)
leucine-rich repeat 625..655 CDD:275380
leucine-rich repeat 656..679 CDD:275380
leucine-rich repeat 680..703 CDD:275380
leucine-rich repeat 704..727 CDD:275380
leucine-rich repeat 728..751 CDD:275380
leucine-rich repeat 752..770 CDD:275380
TPKR_C2 786..>825 CDD:417692
TIR_2 893..1030 CDD:419986
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.