| Sequence 1: | NP_647931.1 | Gene: | CG7509 / 38579 | FlyBaseID: | FBgn0035575 | Length: | 615 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_017945746.2 | Gene: | LOC100493904 / 100493904 | -ID: | - | Length: | 1527 | Species: | Xenopus tropicalis |
| Alignment Length: | 208 | Identity: | 55/208 - (26%) |
|---|---|---|---|
| Similarity: | 97/208 - (46%) | Gaps: | 9/208 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 341 DDDFFAGLRSLRTLSLHNNRISSLSGTIFN--NLANLVTLDLTTNRISHIDGNAFVELNNLNELF 403
Fly 404 LGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPL 468
Fly 469 SQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREF--VLKLWDGQQP 531
Fly 532 MCRGPGDLGGHEV 544 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7509 | NP_647931.1 | LRR_8 | 182..241 | CDD:290566 | |
| leucine-rich repeat | 187..206 | CDD:275380 | |||
| LRR_RI | <201..386 | CDD:238064 | 12/46 (26%) | ||
| leucine-rich repeat | 207..230 | CDD:275380 | |||
| leucine-rich repeat | 231..254 | CDD:275380 | |||
| LRR_8 | 253..313 | CDD:290566 | |||
| leucine-rich repeat | 255..278 | CDD:275380 | |||
| leucine-rich repeat | 279..302 | CDD:275380 | |||
| LRR_8 | 303..361 | CDD:290566 | 6/19 (32%) | ||
| leucine-rich repeat | 303..326 | CDD:275380 | |||
| leucine-rich repeat | 327..350 | CDD:275380 | 3/8 (38%) | ||
| LRR_8 | 349..407 | CDD:290566 | 14/59 (24%) | ||
| LRR_4 | 350..390 | CDD:289563 | 10/41 (24%) | ||
| leucine-rich repeat | 351..374 | CDD:275380 | 5/24 (21%) | ||
| leucine-rich repeat | 375..398 | CDD:275380 | 6/22 (27%) | ||
| LRR_8 | 398..>443 | CDD:290566 | 8/44 (18%) | ||
| leucine-rich repeat | 399..422 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 423..443 | CDD:275380 | 3/19 (16%) | ||
| leucine-rich repeat | 471..494 | CDD:275380 | 7/22 (32%) | ||
| LRRCT | 503..554 | CDD:214507 | 14/44 (32%) | ||
| LOC100493904 | XP_017945746.2 | inl_like_NEAT_1 | <37..>219 | CDD:411101 | 48/185 (26%) |
| leucine-rich repeat | 70..93 | CDD:275378 | 6/22 (27%) | ||
| leucine-rich repeat | 94..117 | CDD:275378 | 5/22 (23%) | ||
| LRR_8 | 118..176 | CDD:404697 | 14/57 (25%) | ||
| leucine-rich repeat | 118..141 | CDD:275378 | 4/22 (18%) | ||
| leucine-rich repeat | 142..165 | CDD:275378 | 7/22 (32%) | ||
| leucine-rich repeat | 166..179 | CDD:275378 | 3/12 (25%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||