DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and lrrtm1

DIOPT Version :10

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_002935525.1 Gene:lrrtm1 / 100493874 XenbaseID:XB-GENE-966481 Length:521 Species:Xenopus tropicalis


Alignment Length:152 Identity:35/152 - (23%)
Similarity:47/152 - (30%) Gaps:65/152 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 DTGDIRLWDIRS------DKIVHTLETKS----------PVTSAEVSQD---GRY---ITTADGS 203
            ||..:|| ..:|      |.::.|...::          ||.|..:|..   |.|   :......
 Frog    24 DTVKVRL-QTQSRYRGILDCVIQTYRNETIFGFFKGMSFPVGSVAISNSLAFGSYSNALLYLSDQ 87

  Fly   204 SVKFWDAKNFGLLKSYDMPCNVESASLEPKHG-NTFIAG------------GEDMWVHRFDFQTG 255
            .:|.|  ||                   |.|. :.|:||            ..|:...|...|| 
 Frog    88 EIKNW--KN-------------------PPHNCHVFMAGCFSGIVQLSFSAPVDLVKVRLQNQT- 130

  Fly   256 EEIG--CNKGH-----HGPVHC 270
            |..|  ...||     .|||||
 Frog   131 ESFGNQARPGHLQARYQGPVHC 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR 185..>437 CDD:443914 27/112 (24%)
leucine-rich repeat 187..206 CDD:275380 4/24 (17%)
leucine-rich repeat 207..230 CDD:275380 3/22 (14%)
leucine-rich repeat 231..254 CDD:275380 7/35 (20%)
leucine-rich repeat 255..278 CDD:275380 9/23 (39%)
leucine-rich repeat 279..302 CDD:275380
leucine-rich repeat 303..326 CDD:275380
leucine-rich repeat 327..350 CDD:275380
leucine-rich repeat 351..374 CDD:275380
leucine-rich repeat 375..398 CDD:275380
leucine-rich repeat 399..422 CDD:275380
leucine-rich repeat 423..443 CDD:275380
leucine-rich repeat 471..494 CDD:275380
PCC 476..>561 CDD:188093
lrrtm1XP_002935525.1 LRR <48..333 CDD:443914 28/127 (22%)
leucine-rich repeat 70..90 CDD:275380 2/19 (11%)
leucine-rich repeat 91..114 CDD:275380 8/43 (19%)
leucine-rich repeat 115..138 CDD:275380 6/23 (26%)
leucine-rich repeat 139..162 CDD:275380 7/14 (50%)
leucine-rich repeat 163..186 CDD:275380
leucine-rich repeat 187..210 CDD:275380
leucine-rich repeat 211..234 CDD:275380
leucine-rich repeat 235..257 CDD:275380
leucine-rich repeat 258..281 CDD:275380
leucine-rich repeat 282..300 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.