DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and lrrc4

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_002939414.1 Gene:lrrc4 / 100493671 XenbaseID:XB-GENE-968937 Length:641 Species:Xenopus tropicalis


Alignment Length:389 Identity:100/389 - (25%)
Similarity:151/389 - (38%) Gaps:115/389 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 WNHCTS--------GVCRCNPDTKSFTCWNTNLKSVPVTQVIPMNMVNIDLSRNILSTLHKDTFR 202
            |..|.:        .||.|:.......|....|..||  |.||.|..:::|..|.:..:..||||
 Frog    28 WISCAAYSGPQSCPSVCSCSNQFSKVVCTRRGLSEVP--QGIPSNTRSLNLMENNIQMIQADTFR 90

  Fly   203 GLTVLKELDISHNVLDFLPFDLFQDLDSLLVLRIQNNQLEDIDHRTFWKLRNLNILDLSKNEIGM 267
            .|         |:               |.||::..|.:..|:...|..|.:||.|:|..|.:.:
 Frog    91 HL---------HH---------------LEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTV 131

  Fly   268 LPESIFYHAQRLTVINMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDF 332
            :|                                                ||:..||:||:.|  
 Frog   132 IP------------------------------------------------SGAFEYLSKLREL-- 146

  Fly   333 GWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDL-TTNRISHIDGNAFVEL 396
             |                     |.||.|.|:....||.:.:|:.||| ...::.:|...||..|
 Frog   147 -W---------------------LRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGL 189

  Fly   397 NNLNELFLGQNSMSSIPADLFLNVS---ALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILK 458
            .||..|.||..::..:|     |::   .|..|.:..||...::...|.||.:||.|.:.|:.:.
 Frog   190 YNLKYLNLGMCNIRDMP-----NLTPLVGLEELEISGNNFPEIKPGSFHGLRSLKKLWIMNSQIN 249

  Fly   459 NFDARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNPWHCDCRALYLARWIREFV 522
            ..:..||:.|:.|.:|.:..|.:..|||.....||.||.:.|..|||.|||..|:|:.|:||::
 Frog   250 TIERNAFDDLTSLVELNLAHNNVTSLPHDLFAPLKYLVELHLHHNPWDCDCDVLWLSWWLREYI 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 13/58 (22%)
leucine-rich repeat 187..206 CDD:275380 7/18 (39%)
LRR_RI <201..386 CDD:238064 36/185 (19%)
leucine-rich repeat 207..230 CDD:275380 1/22 (5%)
leucine-rich repeat 231..254 CDD:275380 7/22 (32%)
LRR_8 253..313 CDD:290566 6/59 (10%)
leucine-rich repeat 255..278 CDD:275380 6/22 (27%)
leucine-rich repeat 279..302 CDD:275380 0/22 (0%)
LRR_8 303..361 CDD:290566 11/57 (19%)
leucine-rich repeat 303..326 CDD:275380 4/22 (18%)
leucine-rich repeat 327..350 CDD:275380 3/22 (14%)
LRR_8 349..407 CDD:290566 20/58 (34%)
LRR_4 350..390 CDD:289563 12/40 (30%)
leucine-rich repeat 351..374 CDD:275380 7/22 (32%)
leucine-rich repeat 375..398 CDD:275380 8/23 (35%)
LRR_8 398..>443 CDD:290566 12/47 (26%)
leucine-rich repeat 399..422 CDD:275380 6/25 (24%)
leucine-rich repeat 423..443 CDD:275380 5/19 (26%)
leucine-rich repeat 471..494 CDD:275380 7/22 (32%)
LRRCT 503..554 CDD:214507 11/20 (55%)
lrrc4XP_002939414.1 LRRNT 40..71 CDD:214470 10/32 (31%)
LRR <68..285 CDD:227223 74/317 (23%)
leucine-rich repeat 71..94 CDD:275380 7/31 (23%)
leucine-rich repeat 95..118 CDD:275380 7/22 (32%)
leucine-rich repeat 119..142 CDD:275380 10/70 (14%)
leucine-rich repeat 143..166 CDD:275380 10/46 (22%)
leucine-rich repeat 167..191 CDD:275380 8/23 (35%)
leucine-rich repeat 192..213 CDD:275380 6/25 (24%)
leucine-rich repeat 214..237 CDD:275380 7/22 (32%)
leucine-rich repeat 238..261 CDD:275380 7/22 (32%)
leucine-rich repeat 262..283 CDD:275380 6/20 (30%)
LRRCT 294..345 CDD:214507 11/20 (55%)
IG_like 353..435 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.