| Sequence 1: | NP_647931.1 | Gene: | CG7509 / 38579 | FlyBaseID: | FBgn0035575 | Length: | 615 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031758515.1 | Gene: | lrfn2 / 100491687 | XenbaseID: | XB-GENE-6035533 | Length: | 765 | Species: | Xenopus tropicalis |
| Alignment Length: | 316 | Identity: | 80/316 - (25%) |
|---|---|---|---|
| Similarity: | 133/316 - (42%) | Gaps: | 52/316 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 284 MCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGL 348
Fly 349 RSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIP 413
Fly 414 ADLFLN-VSALTRLTLFSNNLTTLEADDFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRID 477
Fly 478 SNKLMFLPHGALHGLKNL-----------VAVKLDKNPWHCDCRALYLARWIREFVLKLWDGQQP 531
Fly 532 MCRGPGDLGGHEVGLLRYDD-LC---------------DGQWASM--LSLSPRLPV 569 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7509 | NP_647931.1 | LRR_8 | 182..241 | CDD:290566 | |
| leucine-rich repeat | 187..206 | CDD:275380 | |||
| LRR_RI | <201..386 | CDD:238064 | 25/101 (25%) | ||
| leucine-rich repeat | 207..230 | CDD:275380 | |||
| leucine-rich repeat | 231..254 | CDD:275380 | |||
| LRR_8 | 253..313 | CDD:290566 | 5/28 (18%) | ||
| leucine-rich repeat | 255..278 | CDD:275380 | |||
| leucine-rich repeat | 279..302 | CDD:275380 | 2/17 (12%) | ||
| LRR_8 | 303..361 | CDD:290566 | 13/57 (23%) | ||
| leucine-rich repeat | 303..326 | CDD:275380 | 2/22 (9%) | ||
| leucine-rich repeat | 327..350 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 349..407 | CDD:290566 | 18/57 (32%) | ||
| LRR_4 | 350..390 | CDD:289563 | 13/39 (33%) | ||
| leucine-rich repeat | 351..374 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 375..398 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 398..>443 | CDD:290566 | 16/45 (36%) | ||
| leucine-rich repeat | 399..422 | CDD:275380 | 7/23 (30%) | ||
| leucine-rich repeat | 423..443 | CDD:275380 | 8/19 (42%) | ||
| leucine-rich repeat | 471..494 | CDD:275380 | 7/22 (32%) | ||
| LRRCT | 503..554 | CDD:214507 | 16/66 (24%) | ||
| lrfn2 | XP_031758515.1 | LRR_8 | 51..111 | CDD:404697 | 20/74 (27%) |
| leucine-rich repeat | 53..76 | CDD:275380 | 7/37 (19%) | ||
| leucine-rich repeat | 77..100 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 100..160 | CDD:404697 | 19/59 (32%) | ||
| leucine-rich repeat | 101..124 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 125..148 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 148..208 | CDD:404697 | 19/59 (32%) | ||
| leucine-rich repeat | 150..173 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 174..197 | CDD:275380 | 6/22 (27%) | ||
| LRRCT | 241..285 | CDD:214507 | 15/50 (30%) | ||
| Ig | 288..375 | CDD:416386 | 7/31 (23%) | ||
| Ig strand A | 288..291 | CDD:409353 | 0/2 (0%) | ||
| Ig strand A' | 295..298 | CDD:409353 | 0/2 (0%) | ||
| Ig strand B | 304..312 | CDD:409353 | 2/7 (29%) | ||
| Ig strand C | 318..323 | CDD:409353 | 1/1 (100%) | ||
| Ig strand C' | 326..328 | CDD:409353 | |||
| Ig strand D | 334..338 | CDD:409353 | |||
| Ig strand E | 341..345 | CDD:409353 | |||
| Ig strand F | 355..362 | CDD:409353 | |||
| Ig strand G | 365..375 | CDD:409353 | |||
| fn3 | 417..485 | CDD:394996 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||