DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and lrrtm4

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_031755133.1 Gene:lrrtm4 / 100485215 XenbaseID:XB-GENE-949702 Length:622 Species:Xenopus tropicalis


Alignment Length:433 Identity:108/433 - (24%)
Similarity:174/433 - (40%) Gaps:88/433 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 FDLVKRVRQIESRLRSVEQPVWHLATGSQIEWNHCTSGVCRCNPDTKSFTCWNTNLKSVPVTQVI 179
            |.|:.:::.:...|..:...:..:..|:|   ..|... |||  |.|...|.:...:.:|  |.|
 Frog     3 FQLMNQLKGMSLTLLLLPALIVVMVVGAQ---KTCPKN-CRC--DGKIVYCESHAFRDIP--QNI 59

  Fly   180 PMNMVNIDLSRNILSTLHKDTFRGLTVLKELDISHNVLDFLPFDLFQDLDSLLVLRIQNNQLEDI 244
            ......:.|..|.:..|....|.||..|..|.:.||.:..:..|.||.:..|..|.:.:|::..:
 Frog    60 SGGSQGLSLRYNSIKMLKSHQFSGLNQLVWLYLDHNYISTVDEDAFQGIRRLKELILSSNKISYL 124

  Fly   245 DHRTFWKLRNLNILDLSKNEIGMLPESIFYHAQRLTVINMCDNQIQNFPPNLLRDQLMLEELDMS 309
            .:.||..:.||..||||.|::..|....|...::|.::::..|.::..|..:.:|         .
 Frog   125 GNSTFHPVPNLRNLDLSYNKLQTLQSEQFKGLRKLLILHLRSNSLKTVPVRVFQD---------C 180

  Fly   310 RNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDFFAGLRSLRTLSLHNNRISSLSGTIFNNLAN 374
            ||               |..||.|:|::..:..:.||||..|:.|.|.:|:.|.:      |.|:
 Frog   181 RN---------------LDFLDLGYNRLRSLSRNAFAGLLKLKELHLEHNQFSKV------NFAH 224

  Fly   375 LVTLDLTTNRISHIDGNAFVELNNLNELFLGQNSMSSIPADLFLNVSALTRLTLFSNNLTTLEAD 439
                              |..|.||..|:|..|.:.||...|....|||..|.|..|::..||..
 Frog   225 ------------------FPRLFNLRSLYLQWNKIRSISQGLTWTWSALQNLDLSGNDIQNLEPG 271

  Fly   440 DFQGLNNLKILLLNNNILKNFDARAFEPLSQLEKLRIDSNKLMFLPHGALHGLKNLVAVKLDKNP 504
            .||.|.|                        |:||.:|||||..:....|:...:|.::.|..|.
 Frog   272 TFQCLPN------------------------LQKLNLDSNKLTNVTQETLNAWISLTSITLSGNI 312

  Fly   505 WHCDCRALYLARWIREFVLKLWDGQQP---MCRGPGDLGGHEV 544
            |.|..:...|..|::.|     .|.:.   :|..|.::.|.:|
 Frog   313 WECTKKICPLVFWLKNF-----KGNKESIMICASPKNMQGEKV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 16/58 (28%)
leucine-rich repeat 187..206 CDD:275380 6/18 (33%)
LRR_RI <201..386 CDD:238064 46/184 (25%)
leucine-rich repeat 207..230 CDD:275380 7/22 (32%)
leucine-rich repeat 231..254 CDD:275380 5/22 (23%)
LRR_8 253..313 CDD:290566 15/59 (25%)
leucine-rich repeat 255..278 CDD:275380 8/22 (36%)
leucine-rich repeat 279..302 CDD:275380 4/22 (18%)
LRR_8 303..361 CDD:290566 15/57 (26%)
leucine-rich repeat 303..326 CDD:275380 2/22 (9%)
leucine-rich repeat 327..350 CDD:275380 9/22 (41%)
LRR_8 349..407 CDD:290566 13/57 (23%)
LRR_4 350..390 CDD:289563 7/39 (18%)
leucine-rich repeat 351..374 CDD:275380 6/22 (27%)
leucine-rich repeat 375..398 CDD:275380 2/22 (9%)
LRR_8 398..>443 CDD:290566 17/44 (39%)
leucine-rich repeat 399..422 CDD:275380 7/22 (32%)
leucine-rich repeat 423..443 CDD:275380 7/19 (37%)
leucine-rich repeat 471..494 CDD:275380 9/22 (41%)
LRRCT 503..554 CDD:214507 11/45 (24%)
lrrtm4XP_031755133.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.