DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7509 and LOC100485206

DIOPT Version :9

Sequence 1:NP_647931.1 Gene:CG7509 / 38579 FlyBaseID:FBgn0035575 Length:615 Species:Drosophila melanogaster
Sequence 2:XP_002931661.1 Gene:LOC100485206 / 100485206 -ID:- Length:790 Species:Xenopus tropicalis


Alignment Length:336 Identity:95/336 - (28%)
Similarity:147/336 - (43%) Gaps:65/336 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 HLANFD-LVKRVRQIESRLRSVEQ-PVWHLATGSQIEWNHCTSGVCRCNPDT------KSFTCWN 167
            |.|.|. |::.::.:..:..:::| |:|.... |.:|..|.   :|..:||.      :||...|
 Frog   468 HTAAFAFLMEHLQTLTVKFDNIQQIPLWIYGL-SCLEELHL---ICSQSPDVAKNITFESFKNLN 528

  Fly   168 TNLKSVPV-TQV--IPMNMVNIDLSRNILSTLHKDTFR-----------GLTVLKELDISHNVLD 218
             |||.:.: :|:  ||.|:.:|.|.....| :|.:..:           .||||:.:..:   |.
 Frog   529 -NLKHLFIKSQLSGIPQNVTDISLQLQRFS-IHNEGIKLVIPNSLKKMVNLTVLELIQCN---LG 588

  Fly   219 FLPFDLFQDLDSLLVLRIQNNQLEDIDH-RTFWKLRNLNILDLSKNEIGMLPESIFYHAQRLT-- 280
            .:|..:| .|.:|..|.::.|.|..|.. .:|..|.||.||.|..|:|..:|:    |..:||  
 Frog   589 HVPNSIF-SLRALKELNLEGNNLRSIQELASFQHLHNLTILKLWHNKIAKIPD----HINKLTNL 648

  Fly   281 -VINMCDNQIQNFPPNLLRDQLMLEELDMSRNKISELSSGSIRYLTKLKTLDFGWNQIAKIDDDF 344
             .:|:..|.|:..|.:|.... .|..||:|.|.|. :....|..|..||......|::..|.::.
 Frog   649 EQLNLSHNNIREIPHSLFLCS-KLRYLDLSYNDIC-IIQPYIWMLQSLKYFSIKCNKVEIIPNEL 711

  Fly   345 FAGLRSLRTLSLHNNRISSLSGTIFNNLANLVTLDLTTNRISHID--GNAFVELN---------N 398
            |. .|.|.||:|..|::..||    .|:.||..|       ||:|  ||....|.         |
 Frog   712 FL-CRRLETLNLGKNKLHCLS----PNIGNLEFL-------SHLDIKGNCIRALPPELGCCKSLN 764

  Fly   399 LNELFLGQNSM 409
            .|||.:..|.|
 Frog   765 KNELIIEDNMM 775

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7509NP_647931.1 LRR_8 182..241 CDD:290566 16/69 (23%)
leucine-rich repeat 187..206 CDD:275380 4/29 (14%)
LRR_RI <201..386 CDD:238064 56/199 (28%)
leucine-rich repeat 207..230 CDD:275380 5/22 (23%)
leucine-rich repeat 231..254 CDD:275380 7/23 (30%)
LRR_8 253..313 CDD:290566 21/62 (34%)
leucine-rich repeat 255..278 CDD:275380 8/22 (36%)
leucine-rich repeat 279..302 CDD:275380 7/25 (28%)
LRR_8 303..361 CDD:290566 19/57 (33%)
leucine-rich repeat 303..326 CDD:275380 8/22 (36%)
leucine-rich repeat 327..350 CDD:275380 5/22 (23%)
LRR_8 349..407 CDD:290566 22/68 (32%)
LRR_4 350..390 CDD:289563 14/41 (34%)
leucine-rich repeat 351..374 CDD:275380 8/22 (36%)
leucine-rich repeat 375..398 CDD:275380 8/33 (24%)
LRR_8 398..>443 CDD:290566 6/12 (50%)
leucine-rich repeat 399..422 CDD:275380 5/11 (45%)
leucine-rich repeat 423..443 CDD:275380
leucine-rich repeat 471..494 CDD:275380
LRRCT 503..554 CDD:214507
LOC100485206XP_002931661.1 Pannexin_like 1..324 CDD:372171
leucine-rich repeat 411..431 CDD:275380
leucine-rich repeat 432..454 CDD:275380
leucine-rich repeat 479..501 CDD:275380 3/22 (14%)
leucine-rich repeat 502..529 CDD:275380 8/30 (27%)
LRR 520..784 CDD:227223 82/280 (29%)
leucine-rich repeat 530..552 CDD:275380 7/21 (33%)
leucine-rich repeat 553..576 CDD:275380 2/23 (9%)
leucine-rich repeat 577..599 CDD:275380 8/25 (32%)
leucine-rich repeat 600..624 CDD:275380 7/23 (30%)
leucine-rich repeat 625..647 CDD:275380 9/25 (36%)
leucine-rich repeat 648..670 CDD:275380 5/22 (23%)
leucine-rich repeat 694..716 CDD:275380 5/22 (23%)
leucine-rich repeat 717..739 CDD:275380 10/25 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.